StarFunc result for job id Q8IYA6

User Input

>input (745 residues)
MVGPGPTAAAAVEERQRKLQEYLAAKGKLKSQNTKPYLKSKNNCQNQPPSKSTIRPKNDV
TNHVVLPVKPKRSISIKLQPRPPNTAGSQKPKLEPPKLLGKRLTSECVSSNPYSKPSSKS
FQQCEAGSSTTGELSRKPVGSLNIEQLKTTKQQLTDQGNGKCIDFMNNIHVENESLDNFL
KETNKENLLDILTEPERKPDPKLYTRSKPKTDSYNQTKNSLVPKQALGKSSVNSAVLKDR
VNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPSHFIRTLSKVQSSKKPVVKNI
KDIKVNRSQYERPNETKIRSYPVTEQRVKHTKPRTYPSLLQGEYNNRHPNIKQDQKSSQV
CIPQTSCVLQKSKAISQRPNLTVGRFNSAIPSTPSIRPNGTSGNKHNNNGFQQKAQTLDS
KLKKAVPQNHFLNKTAPKTQADVTTVNGTQTNPNIKKKATAEDRRKQLEEWQKSKGKTYK
RPPMELKTKRKVIKEMNISFWKSIEKEEEEKKAQLELSSKINNTLTECLNLIEGGVPSNE
ILNILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIKNGATPIQELRKVVLNILQ
DSNRTTEGITSDSLVAETSITSVEELAKKMESVKSCLSPKEREQVTATPRIAKAEQHNYP
GIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRYPEMLQEHDLVVASLDELLEV
EETKCFIFRRNEALPVTLGFQTPES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYA6	1.000	1.000	8.402E-100	745	1.000	1.000	Q8IYA6.pdb.gz	CKP2L_HUMAN Cytoskeleton-associated protein 2-like OS=Homo sapiens OX=9606 GN=CKAP2L PE=1 SV=4
2	PDB:6tljS	0.092	0.211	1.160E-2	293	0.036	0.092	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
3	AFDB:O94988	0.069	0.054	3.436E-2	1023	0.111	0.081	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
4	AFDB:Q96ST2	0.068	0.063	3.878E-2	819	0.132	0.120	Q96ST2.pdb.gz	IWS1_HUMAN Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2
5	AFDB:E9QAP7	0.062	0.048	4.378E-2	1042	0.121	0.086	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
6	AFDB:Q8BI84	0.052	0.026	4.378E-2	1930	0.132	0.051	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
7	AFDB:Q5BI31	0.075	0.046	9.616E-2	1322	0.150	0.085	Q5BI31.pdb.gz	ALMS1_DROME Centrosome-associated protein Alms1a OS=Drosophila melanogaster OX=7227 GN=Alms1a PE=1 SV=1
8	AFDB:O00268	0.063	0.046	1.871E-1	1085	0.134	0.092	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
9	AFDB:O60237	0.051	0.044	1.988E-1	982	0.113	0.086	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
10	AFDB:Q9H2G2	0.069	0.046	2.112E-1	1235	0.148	0.089	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
11	AFDB:F4I171	0.052	0.035	2.244E-1	1335	0.123	0.069	F4I171.pdb.gz	MD15A_ARATH Mediator of RNA polymerase II transcription subunit 15a OS=Arabidopsis thaliana OX=3702 GN=MED15A PE=1 SV=1
12	PDB:4cguA	0.094	0.458	3.655E-1	112	0.015	0.098	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
13	PDB:7ajtUM	0.071	0.071	6.302E-1	762	0.021	0.021	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7aqrV	0.054	0.154	8.028E-1	140	0.023	0.121	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
15	PDB:5nrlJ	0.077	0.073	8.529E-1	800	0.031	0.029	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
16	PDB:6erpA	0.091	0.070	1.154	1011	0.036	0.027	6erpA.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
17	PDB:7qskQ	0.063	0.240	1.154	129	0.019	0.109	7qskQ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
18	PDB:7acjy	0.076	0.439	1.226	86	0.017	0.151	7acjy.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
19	PDB:7wooD	0.053	0.032	1.471	1398	0.023	0.012	7wooD.pdb.gz
20	PDB:2y4uA	0.065	0.096	1.562	424	0.021	0.038	2y4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYA6	0.0	1518	745	1.000	1.000	CKP2L_HUMAN Cytoskeleton-associated protein 2-like OS=Homo sapiens OX=9606 GN=CKAP2L PE=1 SV=4
2	Q3V1H1	1.08e-35	146	664	0.142	0.160	CKAP2_MOUSE Cytoskeleton-associated protein 2 OS=Mus musculus OX=10090 GN=Ckap2 PE=1 SV=1
3	Q8WWK9	3.09e-34	141	683	0.136	0.148	CKAP2_HUMAN Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1
4	Q8IBX1	3.0	33.9	2267	0.023	0.007	Q8IBX1_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0712300 PE=4 SV=1
5	P68543	3.8	32.7	259	0.071	0.205	UBX2A_HUMAN UBX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=UBXN2A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15297 CKAP2_C	8.1e-48	174.9	Cytoskeleton-associated protein 2 C-terminus
2	PF13892 DBINO	28	16.5	DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356379	0.917	Abnormal spindle-like microcephaly-associated protein
2	9606.ENSP00000265148	0.901	Centromere-associated protein E
3	9606.ENSP00000376457	0.898	Protein ECT2
4	9606.ENSP00000265295	0.884	Protein Spindly
5	9606.ENSP00000378699	0.880	Cyclin-dependent kinase 1
6	9606.ENSP00000378356	0.871	Kinesin-like protein KIF20A
7	9606.ENSP00000261597	0.862	Kinetochore protein NDC80 homolog
8	9606.ENSP00000362146	0.846	Borealin
9	9606.ENSP00000453403	0.843	Nucleolar and spindle-associated protein 1
10	9606.ENSP00000302530	0.837	Mitotic checkpoint serine/threonine-protein kinase BUB1
11	9606.ENSP00000361540	0.837	Cell division cycle protein 20 homolog
12	9606.ENSP00000377793	0.830	Protein regulator of cytokinesis 1
13	9606.ENSP00000251496	0.827	Condensin complex subunit 3
14	9606.ENSP00000216911	0.825	Aurora kinase A
15	9606.ENSP00000274026	0.825	Cyclin-A2
16	9606.ENSP00000300403	0.824	Targeting protein for Xklp2
17	9606.ENSP00000298048	0.817	Maternal embryonic leucine zipper kinase
18	9606.ENSP00000263753	0.816	Shugoshin 1
19	9606.ENSP00000361298	0.794	Kinesin-like protein KIF2C
20	9606.ENSP00000313950	0.790	Aurora kinase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0000278	0.960	mitotic cell cycle
GO:1903047	0.887	mitotic cell cycle process
GO:0071840	0.725	cellular component organization or biogenesis
GO:0016043	0.701	cellular component organization
GO:0048518	0.700	positive regulation of biological process
GO:0048522	0.693	positive regulation of cellular process
GO:0051128	0.685	regulation of cellular component organization
GO:0019222	0.602	regulation of metabolic process
GO:0060255	0.591	regulation of macromolecule metabolic process
GO:0051171	0.591	regulation of nitrogen compound metabolic process
GO:0080090	0.564	regulation of primary metabolic process
GO:0006996	0.534	organelle organization
GO:0033043	0.531	regulation of organelle organization
GO:0031323	0.471	regulation of cellular metabolic process
GO:0048519	0.435	negative regulation of biological process
GO:0007059	0.410	chromosome segregation
GO:0009893	0.402	positive regulation of metabolic process
GO:0048523	0.396	negative regulation of cellular process
GO:0051726	0.352	regulation of cell cycle
GO:0051301	0.326	cell division
GO:0051129	0.314	negative regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0072686	0.999	mitotic spindle
GO:0005813	0.999	centrosome
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0005634	0.610	nucleus
GO:0070013	0.555	intracellular organelle lumen
GO:0031981	0.552	nuclear lumen
GO:0005654	0.495	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]