StarFunc result for job id Q8IYA7

User Input

>input (352 residues)
MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHR
RTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNW
FANARRRLKNTVRQPDLSWALRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEG
GYNTPVHHPVIKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
MMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKGPSK
DDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZUL2	0.328	0.363	8.649E-37	315	0.722	0.806	D3ZUL2.pdb.gz	D3ZUL2_RAT Mohawk homeobox OS=Rattus norvegicus OX=10116 GN=Mkx PE=4 SV=4
2	AFDB:A5YC44	0.340	0.342	4.406E-34	349	0.702	0.708	A5YC44.pdb.gz	A5YC44_DANRE Homeobox protein Mohawk OS=Danio rerio OX=7955 GN=irxl1a PE=2 SV=1
3	AFDB:Q9VPL4	0.227	0.271	1.852E-8	294	0.230	0.276	Q9VPL4.pdb.gz	Q9VPL4_DROME RE08174p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11617 PE=2 SV=1
4	AFDB:Q90XW5	0.133	0.102	1.420E-7	474	0.216	0.160	Q90XW5.pdb.gz	IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis OX=8355 GN=irx5 PE=2 SV=1
5	AFDB:Q1LXU5	0.190	0.153	7.065E-7	446	0.219	0.173	Q1LXU5.pdb.gz	IRX5A_DANRE Iroquois homeobox protein 5a OS=Danio rerio OX=7955 GN=irx5a PE=2 SV=1
6	AFDB:Q5I8Y1	0.184	0.153	1.896E-6	432	0.190	0.155	Q5I8Y1.pdb.gz
7	AFDB:Q9JKQ4	0.179	0.132	2.921E-6	484	0.207	0.151	Q9JKQ4.pdb.gz	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
8	AFDB:P81066	0.171	0.130	4.786E-6	474	0.222	0.165	P81066.pdb.gz	IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus OX=10090 GN=Irx2 PE=2 SV=2
9	AFDB:A7YYJ6	0.137	0.107	8.872E-6	454	0.188	0.145	A7YYJ6.pdb.gz
10	AFDB:P78413	0.131	0.090	1.136E-5	519	0.230	0.156	P78413.pdb.gz	IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens OX=9606 GN=IRX4 PE=1 SV=2
11	PDB:4egcA	0.138	0.092	5.777E-2	539	0.062	0.041	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.140	0.548	1.721	73	0.034	0.164	2hi3A.pdb.gz
13	PDB:5hbuB	0.113	0.171	2.652	196	0.040	0.071	5hbuB.pdb.gz	Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
14	PDB:1z6rA	0.107	0.099	3.191	382	0.017	0.016	1z6rA.pdb.gz	The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
15	PDB:2ffhA	0.143	0.126	3.394	407	0.043	0.037	2ffhA.pdb.gz
16	PDB:4hi0E	0.065	0.110	3.840	196	0.026	0.046	4hi0E.pdb.gz	Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease.
17	PDB:6h57A	0.104	0.055	4.621	795	0.043	0.019	6h57A.pdb.gz	The DEAH-box RNA helicase Dhr1 contains a remarkable carboxyl terminal domain essential for small ribosomal subunit biogenesis.
18	PDB:6hrzB	0.107	0.171	5.228	202	0.034	0.059	6hrzB.pdb.gz	A fragment-based approach towards the discovery of N-substituted tropinones as inhibitors of Mycobacterium tuberculosis transcriptional regulator EthR2.
19	PDB:5f8cB	0.098	0.095	5.915	363	0.023	0.022	5f8cB.pdb.gz
20	PDB:5mymC	0.114	0.174	6.291	205	0.057	0.098	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZUL2	0.0	633	356	0.884	0.874	D3ZUL2_RAT Mohawk homeobox OS=Rattus norvegicus OX=10116 GN=Mkx PE=4 SV=4
2	Q8BIA3	0.0	653	353	0.892	0.890	MKX_MOUSE Homeobox protein Mohawk OS=Mus musculus OX=10090 GN=Mkx PE=2 SV=1
3	A5YC44	2.92e-158	449	349	0.705	0.711	A5YC44_DANRE Homeobox protein Mohawk OS=Danio rerio OX=7955 GN=irxl1a PE=2 SV=1
4	Q9VPL4	2.63e-19	89.0	294	0.128	0.153	Q9VPL4_DROME RE08174p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11617 PE=2 SV=1
5	Q6DCQ1	5.41e-17	84.0	455	0.111	0.086	IRX2_XENLA Iroquois-class homeodomain protein irx-2 OS=Xenopus laevis OX=8355 GN=irx2 PE=2 SV=1
6	P81066	6.04e-17	84.0	474	0.111	0.082	IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus OX=10090 GN=Irx2 PE=2 SV=2
7	P78412	8.40e-17	83.2	446	0.131	0.103	IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens OX=9606 GN=IRX6 PE=1 SV=3
8	Q9BZI1	9.16e-17	83.2	471	0.111	0.083	IRX2_HUMAN Iroquois-class homeodomain protein IRX-2 OS=Homo sapiens OX=9606 GN=IRX2 PE=1 SV=2
9	Q93348	1.14e-16	82.4	377	0.102	0.095	IRX_CAEEL Putative iroquois-class homeodomain protein irx-1 OS=Caenorhabditis elegans OX=6239 GN=irx-1 PE=2 SV=3
10	Q9ER75	1.34e-16	82.8	438	0.122	0.098	IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus OX=10090 GN=Irx6 PE=2 SV=2
11	Q1LXU5	1.36e-16	82.8	446	0.108	0.085	IRX5A_DANRE Iroquois homeobox protein 5a OS=Danio rerio OX=7955 GN=irx5a PE=2 SV=1
12	Q9YGK8	1.40e-16	82.8	467	0.131	0.099	IRX1A_XENLA Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis OX=8355 GN=irx1-a PE=2 SV=1
13	Q7SZP0	1.59e-16	82.4	432	0.108	0.088	Q7SZP0_DANRE Iroquois homeobox protein 2, a OS=Danio rerio OX=7955 GN=Irx2 PE=2 SV=1
14	Q9JKQ4	2.60e-16	82.0	484	0.108	0.079	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
15	P78411	3.30e-16	81.6	483	0.108	0.079	IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens OX=9606 GN=IRX5 PE=1 SV=3
16	P81068	4.04e-16	81.3	480	0.136	0.100	IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 OS=Mus musculus OX=10090 GN=Irx1 PE=1 SV=4
17	Q90XW5	4.53e-16	81.3	474	0.108	0.080	IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis OX=8355 GN=irx5 PE=2 SV=1
18	Q8JH33	4.56e-16	80.9	419	0.136	0.115	Q8JH33_DANRE Iroquois homeobox protein ziro1-a OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1
19	Q6NZU4	4.58e-16	81.3	440	0.122	0.098	Q6NZU4_DANRE Iroquois homeobox 4a OS=Danio rerio OX=7955 GN=zgc:77362 PE=2 SV=1
20	Q90XQ7	5.56e-16	80.9	426	0.128	0.106	Q90XQ7_DANRE Iroquois homeobox protein Ziro1 OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	4.2e-11	53.9	Homeobox KN domain
2	PF00046 Homeodomain	0.12	23.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290552	0.849	Iroquois-class homeodomain protein IRX-6
2	9606.ENSP00000305244	0.846	Iroquois-class homeodomain protein IRX-1
3	9606.ENSP00000362122	0.842	Tenomodulin
4	9606.ENSP00000476384	0.786	Basic helix-loop-helix transcription factor scleraxis
5	9606.ENSP00000246080	0.738	Transcription factor 15
6	9606.ENSP00000332973	0.692	Mothers against decapentaplegic homolog 3
7	9606.ENSP00000405574	0.688	F-box-like/WD repeat-containing protein TBL1XR1
8	9606.ENSP00000348753	0.677	Sprouty-related, EVH1 domain-containing protein 2
9	9606.ENSP00000221973	0.643	Lens intrinsic membrane protein 2
10	9606.ENSP00000347041	0.630	Fibromodulin
11	9606.ENSP00000306410	0.578	Armadillo repeat-containing protein 4
12	9606.ENSP00000379904	0.574	Thyroid hormone receptor beta
13	9606.ENSP00000296233	0.572	Krueppel-like factor 15
14	9606.ENSP00000225964	0.571	Collagen alpha-1(I) chain
15	9606.ENSP00000052754	0.565	Decorin
16	9606.ENSP00000302836	0.564	Homeobox protein Hox-C9
17	9606.ENSP00000361458	0.564	TSC22 domain family protein 3
18	9606.ENSP00000331479	0.560	Cytochrome b5 domain containing 1
19	9606.ENSP00000318480	0.547	ATP-dependent zinc metalloprotease YME1L1
20	9606.ENSP00000399808	0.544	Homeobox protein Hox-C4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0005515	0.995	protein binding
GO:0043565	0.979	sequence-specific DNA binding
GO:0003690	0.921	double-stranded DNA binding
GO:1990837	0.908	sequence-specific double-stranded DNA binding
GO:0003700	0.901	DNA-binding transcription factor activity
GO:0000981	0.866	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.846	transcription cis-regulatory region binding
GO:0000977	0.734	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.488	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0048856	0.989	anatomical structure development
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0009987	0.981	cellular process
GO:0009892	0.966	negative regulation of metabolic process
GO:0032501	0.920	multicellular organismal process
GO:0009653	0.919	anatomical structure morphogenesis
GO:0031324	0.900	negative regulation of cellular metabolic process
GO:0030154	0.856	cell differentiation
GO:0048513	0.821	animal organ development
GO:0048518	0.804	positive regulation of biological process
GO:0048522	0.771	positive regulation of cellular process
GO:0031327	0.769	negative regulation of cellular biosynthetic process
GO:0006357	0.761	regulation of transcription by RNA polymerase II
GO:0010605	0.744	negative regulation of macromolecule metabolic process
GO:0007275	0.708	multicellular organism development
GO:0009891	0.665	positive regulation of biosynthetic process
GO:0010558	0.657	negative regulation of macromolecule biosynthetic process
GO:0045892	0.572	negative regulation of DNA-templated transcription
GO:0010604	0.571	positive regulation of macromolecule metabolic process
GO:0051173	0.569	positive regulation of nitrogen compound metabolic process
GO:0031328	0.566	positive regulation of cellular biosynthetic process
GO:0045893	0.549	positive regulation of DNA-templated transcription
GO:0050896	0.512	response to stimulus
GO:0048731	0.508	system development
GO:0009887	0.355	animal organ morphogenesis
GO:0045944	0.307	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0005667	0.982	transcription regulator complex
GO:0031981	0.975	nuclear lumen
GO:0005654	0.960	nucleoplasm
GO:0005737	0.789	cytoplasm
GO:0005829	0.486	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]