StarFunc result for job id Q8IYB5

User Input

>input (467 residues)
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKE
PEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLN
DDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQL
SKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVM
GQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWS
LSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYB5	0.999	0.999	1.054E-64	467	1.000	1.000	Q8IYB5.pdb.gz	SMAP1_HUMAN Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1 PE=1 SV=2
2	AFDB:Q91VZ6	0.312	0.331	1.593E-54	440	0.869	0.923	Q91VZ6.pdb.gz	SMAP1_MOUSE Stromal membrane-associated protein 1 OS=Mus musculus OX=10090 GN=Smap1 PE=1 SV=1
3	AFDB:Q8WU79	0.283	0.308	2.339E-31	429	0.450	0.490	Q8WU79.pdb.gz	SMAP2_HUMAN Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1
4	AFDB:Q9FL69	0.262	0.254	1.021E-16	483	0.227	0.219	Q9FL69.pdb.gz	AGD5_ARATH ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana OX=3702 GN=AGD5 PE=1 SV=1
5	AFDB:B8ZZY2	0.267	0.231	1.721E-13	541	0.208	0.179	B8ZZY2.pdb.gz	B8ZZY2_HUMAN ArfGAP with FG repeats 1 OS=Homo sapiens OX=9606 GN=AGFG1 PE=1 SV=1
6	AFDB:A0A0S2Z444	0.279	0.234	3.346E-13	562	0.199	0.165	A0A0S2Z444.pdb.gz	A0A0S2Z444_HUMAN ArfGAP with FG repeats 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=AGFG1 PE=2 SV=1
7	AFDB:F4HXP0	0.257	0.185	3.128E-12	651	0.188	0.135	F4HXP0.pdb.gz	F4HXP0_ARATH ARF GAP-like zinc finger-containing protein ZIGA4 OS=Arabidopsis thaliana OX=3702 GN=ZIGA4 PE=1 SV=1
8	PDB:3ljuX	0.237	0.296	1.601E-11	373	0.101	0.126	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	AFDB:O95081	0.283	0.275	2.162E-11	481	0.203	0.198	O95081.pdb.gz	AGFG2_HUMAN Arf-GAP domain and FG repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=AGFG2 PE=1 SV=2
10	AFDB:Q8W4K6	0.249	0.193	5.350E-11	602	0.214	0.166	Q8W4K6.pdb.gz	Q8W4K6_ARATH At4g13350 OS=Arabidopsis thaliana OX=3702 GN=NIG PE=1 SV=1
11	AFDB:Q54DK4	0.237	0.089	1.674E-9	1352	0.156	0.054	Q54DK4.pdb.gz	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
12	PDB:3lvqE	0.242	0.267	2.561E-9	420	0.096	0.107	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
13	PDB:3o47A	0.188	0.293	8.013E-8	289	0.088	0.142	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
14	PDB:6uanB	0.050	0.072	2.714	261	0.024	0.042	6uanB.pdb.gz
15	PDB:6k15H	0.081	0.093	4.142	393	0.049	0.059	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:3jd5G	0.072	0.119	4.400	208	0.017	0.038	3jd5G.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
17	PDB:6o9l3	0.090	0.121	4.400	309	0.049	0.074	6o9l3.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:4jzqA	0.061	0.098	4.966	237	0.021	0.042	4jzqA.pdb.gz
19	PDB:6ip52F	0.070	0.129	4.966	210	0.051	0.114	6ip52F.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
20	PDB:5mjiA	0.042	0.063	6.323	252	0.019	0.036	5mjiA.pdb.gz	The Crystal Structure of RosB: Insights into the Reaction Mechanism of the First Member of a Family of Flavodoxin-like Enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYB5	0.0	957	467	1.000	1.000	SMAP1_HUMAN Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1 PE=1 SV=2
2	Q91VZ6	0.0	744	440	0.872	0.925	SMAP1_MOUSE Stromal membrane-associated protein 1 OS=Mus musculus OX=10090 GN=Smap1 PE=1 SV=1
3	Q7TN29	2.01e-119	358	428	0.471	0.514	SMAP2_MOUSE Stromal membrane-associated protein 2 OS=Mus musculus OX=10090 GN=Smap2 PE=1 SV=1
4	Q8WU79	3.77e-119	357	429	0.467	0.508	SMAP2_HUMAN Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1
5	A0A087WV97	1.31e-103	317	424	0.430	0.474	A0A087WV97_HUMAN Small ArfGAP2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1
6	X6RCC3	1.33e-59	195	174	0.240	0.644	X6RCC3_HUMAN Small ArfGAP2 (Fragment) OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1
7	Q9FL69	2.88e-38	147	483	0.133	0.128	AGD5_ARATH ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana OX=3702 GN=AGD5 PE=1 SV=1
8	Q9UT34	1.28e-36	139	320	0.137	0.200	YIQ9_SCHPO Uncharacterized protein C824.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC824.09c PE=4 SV=1
9	Q384B0	6.38e-33	128	291	0.111	0.179	Q384B0_TRYB2 ADP-ribosylation factor GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0920 PE=4 SV=1
10	P40529	6.37e-32	125	298	0.135	0.211	AGE2_YEAST ADP-ribosylation factor GTPase-activating protein effector protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGE2 PE=1 SV=1
11	Q580U2	1.22e-30	121	275	0.107	0.182	Q580U2_TRYB2 ADP-ribosylation factor GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.510 PE=4 SV=1
12	Q9FVJ3	2.92e-30	122	337	0.131	0.181	AGD12_ARATH ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana OX=3702 GN=AGD12 PE=1 SV=1
13	O74345	4.30e-29	122	601	0.107	0.083	UCP3_SCHPO UBA domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp3 PE=4 SV=1
14	Q8LFN9	1.64e-28	117	336	0.116	0.161	AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana OX=3702 GN=AGD13 PE=2 SV=1
15	Q8MSZ5	2.72e-24	103	235	0.086	0.170	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
16	Q551Q8	9.15e-24	107	843	0.109	0.060	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
17	Q15057	9.62e-24	107	778	0.103	0.062	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
18	Q54WI0	9.90e-24	107	1333	0.109	0.038	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
19	U6A022	2.57e-23	105	808	0.118	0.068	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
20	Q8VHH5	6.21e-23	104	910	0.118	0.060	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	2.2e-38	142.4	Putative GTPase activating protein for Arf
2	PF09640 DUF2027	5.5e+02	11.5	Domain of unknown function (DUF2027)
3	PF12868 DUF3824	37	16.4	Domain of unknwon function (DUF3824)
4	PF01956 EMC3_TMCO1	3.1	19.0	Integral membrane protein EMC3/TMCO1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359691	0.773	Lengsin
2	9606.ENSP00000359925	0.749	Leucine-rich repeat-containing protein 1
3	9606.ENSP00000298316	0.725	ADP-ribosylation factor 6
4	9606.ENSP00000479606	0.709	Clathrin heavy chain 1
5	9606.ENSP00000403636	0.692	Ras/Rap GTPase-activating protein SynGAP
6	9606.ENSP00000274376	0.690	Ras GTPase-activating protein 1
7	9606.ENSP00000361803	0.684	Stromal membrane-associated protein 2
8	9606.ENSP00000259782	0.679	Tubulointerstitial nephritis antigen
9	9606.ENSP00000296755	0.662	Microtubule-associated protein 1B
10	9606.ENSP00000484105	0.659	DNA primase large subunit
11	9606.ENSP00000360532	0.649	Cell division cycle 5-like protein
12	9606.ENSP00000420211	0.648	Ral guanine nucleotide dissociation stimulator-like 2
13	9606.ENSP00000259392	0.638	Probable low affinity copper uptake protein 2
14	9606.ENSP00000409952	0.626	Vacuolar protein sorting-associated protein 52 homolog
15	9606.ENSP00000359727	0.624	BAG family molecular chaperone regulator 2
16	9606.ENSP00000359000	0.576	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
17	9606.ENSP00000245680	0.563	Solute carrier family 35 member F5
18	9606.ENSP00000359956	0.533	Elongation of very long chain fatty acids protein 5
19	9606.ENSP00000314615	0.528	ADP-ribosylation factor GTPase-activating protein 1
20	9606.ENSP00000330049	0.503	Olfactory receptor 4Q3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.899	molecular function regulator activity
GO:0030234	0.755	enzyme regulator activity
GO:0008047	0.330	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0048518	0.923	positive regulation of biological process
GO:0048522	0.908	positive regulation of cellular process
GO:0009987	0.864	cellular process
GO:0060627	0.850	regulation of vesicle-mediated transport
GO:0051128	0.843	regulation of cellular component organization
GO:0048259	0.778	regulation of receptor-mediated endocytosis
GO:0060284	0.643	regulation of cell development
GO:2000026	0.599	regulation of multicellular organismal development
GO:0002682	0.596	regulation of immune system process
GO:0045637	0.584	regulation of myeloid cell differentiation
GO:2000369	0.522	regulation of clathrin-dependent endocytosis
GO:0045646	0.522	regulation of erythrocyte differentiation
GO:0051234	0.425	establishment of localization
GO:0006810	0.422	transport
GO:0045597	0.413	positive regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.962	organelle
GO:0043229	0.948	intracellular organelle
GO:0043227	0.945	membrane-bounded organelle
GO:0005829	0.936	cytosol
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0070013	0.363	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]