StarFunc result for job id Q8IYB7

User Input

>input (885 residues)
MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIFETYMSKEDVS
EGLKRGTLIQGVLRINPKKFHEAFIPSPDGDRDIFIDGVVARNRALNGDLVVVKLLPEEH
WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHG
ITQNVLVDGVKKLSVCVSEKGREDGDAPVTKDETTCISQDTRALSEKSLQRSAKVVYILE
KKHSRAATGFLKLLADKNSELFRKYALFSPSDHRVPRIYVPLKDCPQDFVARPKDYANTL
FICRIVDWKEDCNFALGQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLP
WTIPPEEFSKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEG
SDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPMSDKLTFSVIWTLTPEGKILDEW
FGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQAVLNLHGIAKQLR
QQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRA
FPEQALLRRHPPPQTRMLSDLVEFCDQMGLPVDFSSAGALNKSLTQTFGDDKYSLARKEV
LTNMCSRPMQMALYFCSGLLQDPAQFRHYALNVPLYTHFTSPIRRFADVLVHRLLAAALG
YRERLDMAPDTLQKQADHCNDRRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQ
AFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLV
EVVLQAESTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CI75	0.884	0.899	0.000	870	0.858	0.872	Q8CI75.pdb.gz	DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus OX=10090 GN=Dis3l2 PE=1 SV=1
2	AFDB:Q8IYB7	1.000	1.000	0.000	885	1.000	1.000	Q8IYB7.pdb.gz	DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2 PE=1 SV=4
3	AFDB:P0DM58	0.741	0.626	4.523E-76	1055	0.350	0.294	P0DM58.pdb.gz	DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana OX=3702 GN=SOV PE=1 SV=1
4	AFDB:O14040	0.720	0.689	1.902E-72	927	0.312	0.298	O14040.pdb.gz	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
5	AFDB:Q8IRJ7	0.718	0.612	5.530E-71	1044	0.303	0.257	Q8IRJ7.pdb.gz	Q8IRJ7_DROME Dis3 like 3'-5' exoribonuclease 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Dis3l2 PE=1 SV=1
6	PDB:4ifdJ	0.693	0.649	1.182E-64	948	0.275	0.256	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
7	PDB:5c0wJ	0.682	0.626	2.012E-63	970	0.293	0.267	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
8	AFDB:Q8IDB6	0.685	0.571	2.302E-63	1073	0.252	0.208	Q8IDB6.pdb.gz	Q8IDB6_PLAF7 Exosome complex exonuclease RRP44 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1359300 PE=3 SV=2
9	AFDB:Q384J0	0.643	0.637	1.567E-59	895	0.269	0.266	Q384J0.pdb.gz	Q384J0_TRYB2 Exosome complex exonuclease RRP44, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0260 PE=3 SV=1
10	PDB:6h25J	0.656	0.668	4.211E-59	868	0.266	0.271	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
11	PDB:5g06J	0.669	0.600	1.878E-57	993	0.294	0.262	5g06J.pdb.gz
12	AFDB:O94525	0.668	0.517	3.602E-50	1157	0.233	0.178	O94525.pdb.gz	YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC609.01 PE=3 SV=1
13	AFDB:O74454	0.658	0.552	1.165E-48	1066	0.209	0.174	O74454.pdb.gz	STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sts5 PE=1 SV=1
14	AFDB:P21499	0.638	0.691	3.967E-46	813	0.183	0.199	P21499.pdb.gz	RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) OX=83333 GN=rnr PE=1 SV=2
15	PDB:2ix1A	0.522	0.694	2.099E-38	643	0.165	0.227	2ix1A.pdb.gz	Unravelling the Dynamics of RNA Degradation by Ribonuclease II and its RNA-Bound Complex
16	PDB:6f3hB	0.407	0.453	2.119E-21	790	0.104	0.116	6f3hB.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
17	PDB:6f4aA	0.291	0.394	4.355E-10	644	0.086	0.118	6f4aA.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
18	PDB:2ckzD	0.077	0.324	2.636E-2	176	0.012	0.062	2ckzD.pdb.gz
19	PDB:2c35B	0.073	0.319	3.094E-2	171	0.014	0.070	2c35B.pdb.gz
20	PDB:7o4kG	0.075	0.342	3.264E-2	171	0.019	0.099	7o4kG.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F350	0.0	1070	995	0.590	0.525	E7F350_DANRE DIS3-like exonuclease 2 OS=Danio rerio OX=7955 GN=dis3l2 PE=1 SV=1
2	Q09568	0.0	606	848	0.386	0.403	DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans OX=6239 GN=disl-2 PE=1 SV=2
3	Q8CI75	0.0	1568	870	0.859	0.874	DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus OX=10090 GN=Dis3l2 PE=1 SV=1
4	Q8IYB7	0.0	1832	885	1.000	1.000	DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2 PE=1 SV=4
5	P0DM58	1.33e-138	441	1055	0.328	0.275	DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana OX=3702 GN=SOV PE=1 SV=1
6	O14040	2.72e-135	429	927	0.316	0.302	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
7	Q9W0T7	8.57e-121	393	1032	0.250	0.214	Q9W0T7_DROME Dis3 like 3'-5' exoribonuclease 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Dis3l2 PE=1 SV=2
8	Q8IRJ7	1.76e-120	392	1044	0.250	0.212	Q8IRJ7_DROME Dis3 like 3'-5' exoribonuclease 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Dis3l2 PE=1 SV=1
9	G3V1J5	1.14e-107	352	796	0.260	0.289	G3V1J5_HUMAN DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=1
10	Q9Y2L1	4.17e-106	352	958	0.260	0.240	RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2
11	Q9VC93	8.64e-105	349	982	0.259	0.233	Q9VC93_DROME Dis3, isoform A OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=1 SV=1
12	Q960A7	2.02e-104	348	982	0.258	0.232	Q960A7_DROME SD10981p OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
13	Q08162	1.40e-101	340	1001	0.304	0.269	RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIS3 PE=1 SV=1
14	Q9BI20	8.15e-99	333	983	0.252	0.227	Q9BI20_DROME Putative exoribonuclease DIS3 OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
15	P37202	3.78e-96	325	970	0.275	0.251	DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis3 PE=1 SV=1
16	Q95Z12	2.13e-90	309	972	0.209	0.190	Q95Z12_9TRYP Rrp44p homologue OS=Trypanosoma brucei OX=5691 GN=RRP44 PE=1 SV=1
17	Q384R7	1.33e-89	307	972	0.211	0.192	Q384R7_TRYB2 Exosome complex exonuclease RRP44p homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5380 PE=3 SV=1
18	Q384J0	1.02e-84	292	895	0.278	0.275	Q384J0_TRYB2 Exosome complex exonuclease RRP44, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0260 PE=3 SV=1
19	Q8TF46	6.67e-84	293	1054	0.217	0.182	DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2
20	Q95Z08	2.99e-83	288	895	0.276	0.273	Q95Z08_9TRYP Putative ribonuclease II-like protein OS=Trypanosoma brucei OX=5691 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17876 CSD2	1.5	20.4	Cold shock domain
2	PF17877 Dis3l2_C_term	4.3e-21	86.4	DIS3-like exonuclease 2 C terminal
3	PF17849 OB_Dis3	6e-24	95.2	Dis3-like cold-shock domain 2 (CSD2)
4	PF08206 OB_RNB	1e+02	14.0	Ribonuclease B OB domain
5	PF00773 RNB	4.5e-93	323.7	RNB domain
6	PF17216 Rrp44_CSD1	1.2e-07	43.0	Rrp44-like cold shock domain
7	PF17215 Rrp44_S1	2.2e+02	13.2	S1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366135	0.957	Exosome component 10
2	9606.ENSP00000323046	0.939	Exosome complex component RRP40
3	9606.ENSP00000264951	0.938	5'-3' exoribonuclease 1
4	9606.ENSP00000308000	0.916	Speckle targeted PIP5K1A-regulated poly(A) polymerase
5	9606.ENSP00000348107	0.916	Nuclear nucleic acid-binding protein C1D
6	9606.ENSP00000352678	0.911	ATP-dependent RNA helicase SUPV3L1, mitochondrial
7	9606.ENSP00000365130	0.910	Terminal uridylyltransferase 7
8	9606.ENSP00000359939	0.903	Exosome complex component CSL4
9	9606.ENSP00000257177	0.896	Terminal uridylyltransferase 4
10	9606.ENSP00000361433	0.883	Exosome complex component RRP4
11	9606.ENSP00000221233	0.879	Exosome complex component RRP46
12	9606.ENSP00000265564	0.871	Exosome complex component RRP42
13	9606.ENSP00000315476	0.860	Exosome complex component RRP41
14	9606.ENSP00000229812	0.853	Serine/threonine-protein kinase 38
15	9606.ENSP00000373684	0.853	Serine/threonine-protein kinase 38-like
16	9606.ENSP00000344401	0.847	Protein lin-28 homolog B
17	9606.ENSP00000368984	0.846	Exosome complex component RRP45
18	9606.ENSP00000374354	0.823	Exosome complex component RRP43
19	9606.ENSP00000398597	0.817	Exosome complex component MTR3
20	9606.ENSP00000437256	0.781	Endoribonuclease Dicer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000287	1.000	magnesium ion binding
GO:0008266	1.000	poly(U) RNA binding
GO:0000175	1.000	3'-5'-RNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.996	nucleic acid metabolic process
GO:0016070	0.985	RNA metabolic process
GO:0006401	0.971	RNA catabolic process
GO:0065007	0.956	biological regulation
GO:0050789	0.950	regulation of biological process
GO:0034660	0.891	ncRNA metabolic process
GO:0019222	0.817	regulation of metabolic process
GO:0050794	0.811	regulation of cellular process
GO:0060255	0.800	regulation of macromolecule metabolic process
GO:0034661	0.772	ncRNA catabolic process
GO:0010468	0.698	regulation of gene expression
GO:0006402	0.528	mRNA catabolic process
GO:0048523	0.427	negative regulation of cellular process
GO:0071840	0.380	cellular component organization or biogenesis
GO:0000956	0.323	nuclear-transcribed mRNA catabolic process
GO:0010467	0.309	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0032991	0.960	protein-containing complex
GO:0005829	0.940	cytosol
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:1990904	0.790	ribonucleoprotein complex
GO:0005634	0.671	nucleus
GO:0099080	0.635	supramolecular complex
GO:0036464	0.526	cytoplasmic ribonucleoprotein granule
GO:0005654	0.402	nucleoplasm
GO:0000932	0.389	P-body
GO:0005844	0.309	polysome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.-	1.000	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]