StarFunc result for job id Q8IYB8

User Input

>input (786 residues)
MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPN
TSLFVPLTVKPQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLF
HQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLR
KISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEI
FEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPA
RGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALES
LDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKI
LVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKE
GEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFS
QVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRN
EPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQK
ELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKA
TEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKK
KEPDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4IG62	0.844	0.869	0.000	763	0.670	0.691	A4IG62.pdb.gz	SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio OX=7955 GN=supv3l1 PE=2 SV=1
2	AFDB:Q80YD1	0.837	0.844	0.000	779	0.873	0.881	Q80YD1.pdb.gz	SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus OX=10090 GN=Supv3l1 PE=1 SV=1
3	AFDB:Q8IYB8	1.000	1.000	0.000	786	1.000	1.000	Q8IYB8.pdb.gz	SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1
4	AFDB:Q9VN03	0.808	0.831	3.217E-92	763	0.541	0.557	Q9VN03.pdb.gz	SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Suv3 PE=2 SV=3
5	AFDB:Q10D00	0.587	0.794	7.209E-55	579	0.253	0.344	Q10D00.pdb.gz	SUV3M_ORYSJ ATP-dependent RNA helicase SUV3, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SUV3 PE=1 SV=1
6	AFDB:Q9SMX1	0.592	0.809	5.799E-54	571	0.266	0.366	Q9SMX1.pdb.gz	SUV3M_ARATH DExH-box ATP-dependent RNA helicase DExH16, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SUV3 PE=1 SV=1
7	AFDB:P32580	0.604	0.643	4.496E-49	737	0.281	0.300	P32580.pdb.gz	SUV3_YEAST ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUV3 PE=1 SV=2
8	AFDB:Q6FKD7	0.585	0.633	8.404E-49	724	0.249	0.271	Q6FKD7.pdb.gz	Q6FKD7_CANGA RNA helicase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SUV3 PE=1 SV=1
9	AFDB:Q59TB2	0.585	0.637	4.945E-48	720	0.242	0.264	Q59TB2.pdb.gz	SUV3_CANAL ATP-dependent RNA helicase SUV3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUV3 PE=3 SV=2
10	AFDB:O94445	0.612	0.739	1.026E-47	647	0.237	0.287	O94445.pdb.gz	SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suv3 PE=3 SV=1
11	PDB:6d6qM	0.363	0.397	6.464E-14	709	0.111	0.123	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
12	PDB:4xgtA	0.303	0.252	1.652E-13	961	0.095	0.078	4xgtA.pdb.gz
13	PDB:7z4yB	0.322	0.276	8.311E-13	930	0.117	0.099	7z4yB.pdb.gz
14	PDB:5xjcY	0.335	0.362	1.553E-12	713	0.115	0.126	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
15	PDB:6ro1A	0.324	0.280	2.483E-12	919	0.104	0.089	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
16	PDB:3kx2B	0.317	0.327	2.756E-12	755	0.108	0.113	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
17	PDB:5ylzW	0.328	0.359	4.642E-12	703	0.113	0.127	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
18	PDB:6zqgJD	0.349	0.333	5.718E-12	829	0.113	0.107	6zqgJD.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
19	PDB:7mqaNS	0.322	0.285	1.461E-11	914	0.103	0.089	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6ff7q	0.334	0.405	1.800E-11	625	0.113	0.142	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4IG62	0.0	1091	763	0.656	0.676	SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio OX=7955 GN=supv3l1 PE=2 SV=1
2	Q80YD1	0.0	1405	779	0.872	0.879	SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus OX=10090 GN=Supv3l1 PE=1 SV=1
3	Q8IYB8	0.0	1632	786	1.000	1.000	SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1
4	Q9VN03	0.0	864	763	0.539	0.556	SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Suv3 PE=2 SV=3
5	Q9SMX1	8.25e-130	400	571	0.266	0.366	SUV3M_ARATH DExH-box ATP-dependent RNA helicase DExH16, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SUV3 PE=1 SV=1
6	Q10D00	6.58e-126	390	579	0.254	0.345	SUV3M_ORYSJ ATP-dependent RNA helicase SUV3, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SUV3 PE=1 SV=1
7	P32580	1.89e-88	296	737	0.257	0.274	SUV3_YEAST ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUV3 PE=1 SV=2
8	Q59TB2	3.27e-88	295	720	0.233	0.254	SUV3_CANAL ATP-dependent RNA helicase SUV3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUV3 PE=3 SV=2
9	O94445	3.71e-87	291	647	0.224	0.272	SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suv3 PE=3 SV=1
10	Q6FKD7	1.57e-84	286	724	0.232	0.251	Q6FKD7_CANGA RNA helicase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SUV3 PE=1 SV=1
11	Q9FT70	7.33e-04	45.8	1150	0.042	0.029	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
12	P35207	0.001	45.1	1287	0.048	0.030	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
13	Q9BI21	0.001	44.7	1197	0.055	0.036	Q9BI21_DROME Putative helicase Ski2 OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=1
14	Q9VCH8	0.001	45.1	1197	0.055	0.036	Q9VCH8_DROME LD23303p OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=2
15	Q6FLV3	0.004	43.5	1371	0.043	0.025	Q6FLV3_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0L00407g PE=3 SV=1
16	Q9Y134	0.006	42.7	1055	0.048	0.036	Q9Y134_DROME L.2.35Df OS=Drosophila melanogaster OX=7227 GN=Mtr4 PE=1 SV=1
17	Q873J5	0.007	42.4	1106	0.025	0.018	Q873J5_NEUCS FRQ-interacting RNA helicase OS=Neurospora crassa OX=5141 GN=B9B11.040 PE=1 SV=1
18	Q56X76	0.021	40.8	621	0.025	0.032	RH39_ARATH DEAD-box ATP-dependent RNA helicase 39 OS=Arabidopsis thaliana OX=3702 GN=RH39 PE=2 SV=2
19	Q8L840	0.025	40.8	1188	0.041	0.027	RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana OX=3702 GN=RECQL4A PE=2 SV=1
20	Q6P7X6	0.026	40.4	1034	0.037	0.028	Q6P7X6_DANRE Superkiller viralicidic activity 2-like 2 OS=Danio rerio OX=7955 GN=skiv2l2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00271 Helicase_C	1.7e-07	42.9	Helicase conserved C-terminal domain
2	PF09045 L27_2	3.1e+02	12.7	L27_2
3	PF12513 SUV3_C	9.1e-13	59.3	Mitochondrial degradasome RNA helicase subunit C terminal
4	PF18147 Suv3_C_1	2.2e-14	64.4	Suv3 C-terminal domain 1
5	PF18114 Suv3_N	1.4e-44	162.3	Suv3 helical N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400646	0.999	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
2	9606.ENSP00000366997	0.982	Exosome complex exonuclease RRP44
3	9606.ENSP00000321711	0.979	DIS3-like exonuclease 1
4	9606.ENSP00000481021	0.969	Putative protein SEM1, isoform 2
5	9606.ENSP00000298139	0.933	Werner syndrome ATP-dependent helicase
6	9606.ENSP00000366135	0.921	Exosome component 10
7	9606.ENSP00000221233	0.916	Exosome complex component RRP46
8	9606.ENSP00000315569	0.911	DIS3-like exonuclease 2
9	9606.ENSP00000359939	0.908	Exosome complex component CSL4
10	9606.ENSP00000361433	0.908	Exosome complex component RRP4
11	9606.ENSP00000265564	0.906	Exosome complex component RRP42
12	9606.ENSP00000263063	0.905	Poly(A) RNA polymerase, mitochondrial
13	9606.ENSP00000323046	0.905	Exosome complex component RRP40
14	9606.ENSP00000315476	0.904	Exosome complex component RRP41
15	9606.ENSP00000348107	0.904	Nuclear nucleic acid-binding protein C1D
16	9606.ENSP00000374354	0.904	Exosome complex component RRP43
17	9606.ENSP00000258169	0.902	M-phase phosphoprotein 6
18	9606.ENSP00000368984	0.902	Exosome complex component RRP45
19	9606.ENSP00000398597	0.902	Exosome complex component MTR3
20	9606.ENSP00000368017	0.900	Zinc finger C3H1 domain-containing protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.999	protein dimerization activity
GO:0042802	0.999	identical protein binding
GO:0003677	0.999	DNA binding
GO:0003725	0.999	double-stranded RNA binding
GO:0003724	0.999	RNA helicase activity
GO:0003678	0.999	DNA helicase activity
GO:0042803	0.990	protein homodimerization activity
GO:0034458	0.785	3'-5' RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006401	0.986	RNA catabolic process
GO:0019222	0.985	regulation of metabolic process
GO:0048518	0.982	positive regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0010467	0.962	gene expression
GO:0071840	0.951	cellular component organization or biogenesis
GO:0051173	0.923	positive regulation of nitrogen compound metabolic process
GO:0006396	0.918	RNA processing
GO:0016043	0.914	cellular component organization
GO:0048522	0.911	positive regulation of cellular process
GO:0060255	0.893	regulation of macromolecule metabolic process
GO:0031323	0.889	regulation of cellular metabolic process
GO:0016071	0.886	mRNA metabolic process
GO:0000959	0.880	mitochondrial RNA metabolic process
GO:0080090	0.879	regulation of primary metabolic process
GO:0010468	0.878	regulation of gene expression
GO:0019219	0.873	regulation of nucleobase-containing compound metabolic process
GO:0031329	0.859	regulation of cellular catabolic process
GO:0010604	0.831	positive regulation of macromolecule metabolic process
GO:0031325	0.827	positive regulation of cellular metabolic process
GO:0048519	0.811	negative regulation of biological process
GO:0010605	0.769	negative regulation of macromolecule metabolic process
GO:0006996	0.744	organelle organization
GO:0048856	0.679	anatomical structure development
GO:0010629	0.529	negative regulation of gene expression
GO:0051252	0.507	regulation of RNA metabolic process
GO:0006402	0.405	mRNA catabolic process
GO:0140053	0.403	mitochondrial gene expression
GO:0045935	0.379	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.308	negative regulation of cellular process
GO:0051254	0.301	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.991	intracellular organelle lumen
GO:0032991	0.954	protein-containing complex
GO:0043232	0.943	intracellular non-membrane-bounded organelle
GO:0005634	0.927	nucleus
GO:0031981	0.911	nuclear lumen
GO:1902494	0.890	catalytic complex
GO:0005759	0.716	mitochondrial matrix
GO:0098798	0.575	mitochondrial protein-containing complex
GO:0005654	0.516	nucleoplasm
GO:0042645	0.512	mitochondrial nucleoid
GO:0000178	0.463	exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.999	RNA helicase.

[back to server]