StarFunc result for job id Q8IYD8

User Input

>input (2048 residues)
MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQLESDDDVLLVA
AYEAERQLCLENGGFCTSAGALWIYPTNCPVRDYQLHISRAALFCNTLVCLPTGLGKTFI
AAVVMYNFYRWFPSGKVVFMAPTKPLVTQQIEACYQVMGIPQSHMAEMTGSTQASTRKEI
WCSKRVLFLTPQVMVNDLSRGACPAAEIKCLVIDEAHKALGNYAYCQVVRELVKYTNHFR
ILALSATPGSDIKAVQQVITNLLIGQIELRSEDSPDILTYSHERKVEKLIVPLGEELAAI
QKTYIQILESFARSLIQRNVLMRRDIPNLTKYQIILARDQFRKNPSPNIVGIQQGIIEGE
FAICISLYHGYELLQQMGMRSLYFFLCGIMDGTKGMTRSKNELGRNEDFMKLYNHLECMF
ARTRSTSANGISAIQQGDKNKKFVYSHPKLKKLEEVVIEHFKSWNAENTTEKKRDETRVM
IFSSFRDSVQEIAEMLSQHQPIIRVMTFVGHASGKSTKGFTQKEQLEVVKQFRDGGYNTL
VSTCVGEEGLDIGEVDLIICFDSQKSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQ
SQSNKRSIYKAISSNRQVLHFYQRSPRMVPDGINPKLHKMFITHGVYEPEKPSRNLQRKS
SIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEIKEITLPQVQFSSLQNEENKP
AQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDRCRHFIGLMQMIEGMRHEEGECSYELE
VESYLQMEDVTSTFIAPRNESNNLASDTFITHKKSSFIKNINQGSSSSVIESDEECAEIV
KQTHIKPTKIVSLKKKVSKEIKKDQLKKENNHGIIDSVDNDRNSTVENIFQEDLPNDKRT
SDTDEIAATCTINENVIKEPCVLLTECQFTNKSTSSLAGNVLDSGYNSFNDEKSVSSNLF
LPFEEELYIVRTDDQFYNCHSLTKEVLANVERFLSYSPPPLSGLSDLEYEIAKGTALENL
LFLPCAEHLRSDKCTCLLSHSAVNSQQNLELNSLKCINYPSEKSCLYDIPNDNISDEPSL
CDCDVHKHNQNENLVPNNRVQIHRSPAQNLVGENNHDVDNSDLPVLSTDQDESLLLFEDV
NTEFDDVSLSPLNSKSESLPVSDKTAISETPLVSQFLISDELLLDNNSELQDQITRDANS
FKSRDQRGVQEEKVKNHEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSDSNRPLDDLY
GRYLEIKEISDANYVSNQALIPRDHSKNFTSGTVIIPSNEDMQNPNYVHLPLSAAKNEEL
LSPGYSQFSLPVQKKVMSTPLSKSNTLNSFSKIRKEILKTPDSSKEKVNLQRFKEALNST
FDYSEFSLEKSKSSGPMYLHKSCHSVEDGQLLTSNESEDDEIFRRKVKRAKGNVLNSPED
QKNSEVDSPLHAVKKRRFPINRSELSSSDESENFPKPCSQLEDFKVCNGNARRGIKVPKR
QSHLKHVARKFLDDEAELSEEDAEYVSSDENDESENEQDSSLLDFLNDETQLSQAINDSE
MRAIYMKSLRSPMMNNKYKMIHKTHKNINIFSQIPEQDETYLEDSFCVDEEESCKGQSSE
EEVCVDFNLITDDCFANSKKYKTRRAVMLKEMMEQNCAHSKKKLSRIILPDDSSEEENNV
NDKRESNIAVNPSTVKKNKQQDHCLNSVPSGSSAQSKVRSTPRVNPLAKQSKQTSLNLKD
TISEVSDFKPQNHNEVQSTTPPFTTVDSQKDCRKFPVPQKDGSALEDSSTSGASCSKSRP
HLAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNR
MVVERRSQSEMLNSVNKNKFIEQIQHLQSMFERICVIVEKDREKTGDTSRMFRRTKSYDS
LLTTLIGAGIRILFSSCQEETADLLKELSLVEQRKNVGIHVPTVVNSNKSEALQFYLSIP
NISYITALNMCHQFSSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVFDIQMLPNDLN
QDRLKSDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYD8	1.000	1.000	0.000	2048	1.000	1.000	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
2	AFDB:Q9UT23	0.259	0.623	1.514E-59	834	0.131	0.321	Q9UT23.pdb.gz	MPH1_SCHPO ATP-dependent DNA helicase fml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fml1 PE=1 SV=2
3	AFDB:Q8T145	0.255	0.291	5.867E-55	1789	0.172	0.197	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
4	AFDB:Q9HE09	0.258	0.657	2.840E-54	783	0.109	0.286	Q9HE09.pdb.gz	MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fml2 PE=3 SV=1
5	PDB:7bkpA	0.208	0.559	3.946E-23	689	0.055	0.164	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
6	PDB:8dvsA	0.202	0.542	6.399E-22	682	0.050	0.150	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
7	PDB:6h61A	0.199	0.548	5.819E-21	660	0.052	0.162	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
8	PDB:7v6cA	0.153	0.193	3.297E-20	1540	0.047	0.063	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
9	PDB:7v6bA	0.145	0.190	1.596E-19	1496	0.047	0.064	7v6bA.pdb.gz
10	PDB:4a2wA	0.131	0.328	9.532E-19	678	0.043	0.130	4a2wA.pdb.gz
11	PDB:7yymA	0.141	0.204	1.059E-18	1281	0.049	0.079	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
12	PDB:7tnxA	0.180	0.488	6.733E-17	647	0.043	0.138	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
13	PDB:7w0dA	0.189	0.243	1.561E-16	1544	0.049	0.065	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
14	PDB:8dgiA	0.148	0.182	6.454E-16	1582	0.051	0.066	8dgiA.pdb.gz
15	AFDB:F4KBP5	0.161	0.149	1.842E-14	2223	0.111	0.102	F4KBP5.pdb.gz	CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana OX=3702 GN=CHR4 PE=2 SV=1
16	AFDB:Q9NEL2	0.156	0.136	2.319E-12	2395	0.116	0.099	Q9NEL2.pdb.gz	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
17	AFDB:Q8CGS6	0.130	0.107	1.220E-8	2544	0.133	0.107	Q8CGS6.pdb.gz	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
18	AFDB:Q6DFV5	0.119	0.124	6.287E-7	1964	0.101	0.105	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
19	AFDB:Q6PR54	0.043	0.040	7.998E-4	2419	0.121	0.102	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
20	AFDB:Q9VHP9	0.037	0.044	3.871E-3	1411	0.085	0.124	Q9VHP9.pdb.gz	Q9VHP9_DROME Centromeric protein-C, isoform A OS=Drosophila melanogaster OX=7227 GN=Cenp-C PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YJ14	0.0	2971	1487	0.709	0.976	H0YJ14_HUMAN FA complementation group M (Fragment) OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
2	H0YJS3	0.0	3983	1979	0.950	0.983	H0YJS3_HUMAN FA complementation group M OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
3	Q8IYD8	0.0	4250	2048	1.000	1.000	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
4	F4HYE4	6.00e-142	481	1390	0.121	0.178	F4HYE4_ARATH DEAD/DEAH box RNA helicase family protein OS=Arabidopsis thaliana OX=3702 GN=FANCM PE=1 SV=1
5	Q9UT23	8.22e-130	431	834	0.116	0.284	MPH1_SCHPO ATP-dependent DNA helicase fml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fml1 PE=1 SV=2
6	Q9VDA0	1.31e-123	430	1489	0.115	0.158	FANCM_DROME DEAD-box ATP-dependent DNA helicase Fancm OS=Drosophila melanogaster OX=7227 GN=Fancm PE=1 SV=2
7	Q8T145	7.25e-113	401	1789	0.107	0.122	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
8	Q9HE09	2.43e-107	365	783	0.097	0.253	MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fml2 PE=3 SV=1
9	P40562	8.20e-77	280	993	0.096	0.198	MPH1_YEAST ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPH1 PE=1 SV=1
10	Q8TZH8	1.20e-69	253	764	0.079	0.212	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
11	O95786	3.04e-19	97.4	925	0.066	0.146	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
12	D3TI84	1.68e-17	91.7	933	0.060	0.132	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
13	Q6Q899	3.24e-14	81.3	926	0.027	0.060	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
14	Q86L44	1.32e-13	79.0	837	0.028	0.069	Q86L44_DICDI RNA helicase OS=Dictyostelium discoideum OX=44689 GN=helF PE=4 SV=1
15	Q8R5F7	3.92e-12	74.3	1025	0.025	0.050	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
16	A7LCX1	6.19e-12	73.6	1023	0.024	0.049	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
17	Q99J87	4.91e-11	70.5	678	0.023	0.069	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
18	Q9BYX4	7.20e-11	70.1	1025	0.023	0.047	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
19	Q54H25	2.35e-10	68.9	2417	0.017	0.014	Q54H25_DICDI RNA-directed RNA polymerase OS=Dictyostelium discoideum OX=44689 GN=rrpA PE=3 SV=1
20	F4HQG6	3.04e-10	68.6	1910	0.036	0.039	F4HQG6_ARATH Dicer-like 1 OS=Arabidopsis thaliana OX=3702 GN=DCL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	4.4e-14	64.1	DEAD/DEAH box helicase
2	PF02732 ERCC4	6.7e-06	37.8	ERCC4 domain
3	PF16783 FANCM-MHF_bd	2.1e-48	174.6	FANCM to MHF binding domain
4	PF00271 Helicase_C	2.4e-16	71.4	Helicase conserved C-terminal domain
5	PF12826 HHH_2	36	15.9	Helix-hairpin-helix motif
6	PF04851 ResIII	5.3e-14	64.1	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229769	0.999	Fanconi anemia group E protein
2	9606.ENSP00000289081	0.999	Fanconi anemia group C protein
3	9606.ENSP00000308583	0.999	Centromere protein S
4	9606.ENSP00000317039	0.999	RecQ-mediated genome instability protein 1
5	9606.ENSP00000330875	0.999	Fanconi anemia group F protein
6	9606.ENSP00000333283	0.999	Fanconi anemia core complex-associated protein 100
7	9606.ENSP00000347232	0.999	Bloom syndrome protein
8	9606.ENSP00000367910	0.999	Fanconi anemia group G protein
9	9606.ENSP00000373952	0.999	Fanconi anemia group A protein
10	9606.ENSP00000376168	0.999	Centromere protein X
11	9606.ENSP00000381378	0.999	Fanconi anemia group B protein
12	9606.ENSP00000383710	0.999	Fanconi anemia core complex-associated protein 20
13	9606.ENSP00000385021	0.999	E3 ubiquitin-protein ligase FANCL
14	9606.ENSP00000466121	0.999	Fanconi anemia core complex-associated protein 24
15	9606.ENSP00000442336	0.998	DNA topoisomerase 3-alpha
16	9606.ENSP00000254719	0.996	Replication protein A 70 kDa DNA-binding subunit
17	9606.ENSP00000307853	0.995	Crossover junction endonuclease MUS81
18	9606.ENSP00000310356	0.994	RecQ-mediated genome instability protein 2
19	9606.ENSP00000287647	0.991	Fanconi anemia group D2 protein
20	9606.ENSP00000343741	0.991	Serine/threonine-protein kinase ATR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.999	chromatin binding
GO:0003676	0.928	nucleic acid binding
GO:0003824	0.882	catalytic activity
GO:0140097	0.862	catalytic activity, acting on DNA
GO:0016787	0.664	hydrolase activity
GO:0003677	0.361	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0050896	0.995	response to stimulus
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006974	0.992	cellular response to DNA damage stimulus
GO:0006259	0.991	DNA metabolic process
GO:0050789	0.990	regulation of biological process
GO:0006310	0.982	DNA recombination
GO:0006281	0.980	DNA repair
GO:0031297	0.971	replication fork processing
GO:0080090	0.966	regulation of primary metabolic process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0048518	0.961	positive regulation of biological process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0000280	0.957	nuclear division
GO:0051321	0.955	meiotic cell cycle
GO:0010604	0.954	positive regulation of macromolecule metabolic process
GO:0007127	0.950	meiosis I
GO:0007131	0.902	reciprocal meiotic recombination
GO:0051173	0.876	positive regulation of nitrogen compound metabolic process
GO:0050794	0.851	regulation of cellular process
GO:0031399	0.793	regulation of protein modification process
GO:1903320	0.776	regulation of protein modification by small protein conjugation or removal
GO:0031401	0.581	positive regulation of protein modification process
GO:0031396	0.505	regulation of protein ubiquitination
GO:1903322	0.505	positive regulation of protein modification by small protein conjugation or removal
GO:0031398	0.498	positive regulation of protein ubiquitination
GO:0031323	0.466	regulation of cellular metabolic process
GO:0007059	0.356	chromosome segregation
GO:0045132	0.350	meiotic chromosome segregation
GO:0036297	0.345	interstrand cross-link repair
GO:0019219	0.320	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.312	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.987	chromosome
GO:0140513	0.930	nuclear protein-containing complex
GO:0000785	0.754	chromatin
GO:0005737	0.517	cytoplasm
GO:0071821	0.435	FANCM-MHF complex
GO:0043240	0.432	Fanconi anaemia nuclear complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.664	Hydrolases.

[back to server]