StarFunc result for job id Q8IYI0

User Input

>input (205 residues)
MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPD
TSNLNIEQNNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSAS
VCKCLSQKITQLRGQESQKYALRSFQMARVIFNRDGCSVLQRHSRDTHFYPLEEGSTSLD
DEKPNPGLSKDITHFLLQQNVMKDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYI0	1.000	1.000	7.743E-31	205	1.000	1.000	Q8IYI0.pdb.gz	SHLD1_HUMAN Shieldin complex subunit 1 OS=Homo sapiens OX=9606 GN=SHLD1 PE=1 SV=1
2	AFDB:Q9Y6A9	0.117	0.135	2.160E-1	169	0.146	0.178	Q9Y6A9.pdb.gz	SPCS1_HUMAN Signal peptidase complex subunit 1 OS=Homo sapiens OX=9606 GN=SPCS1 PE=1 SV=5
3	AFDB:Q9ASV6	0.142	0.144	3.048E-1	202	0.122	0.124	Q9ASV6.pdb.gz	RR20_ARATH Small ribosomal subunit protein bS20c OS=Arabidopsis thaliana OX=3702 GN=RPS20 PE=2 SV=1
4	AFDB:Q06511	0.108	0.094	3.228E-1	250	0.132	0.108	Q06511.pdb.gz	RRP15_YEAST Ribosomal RNA-processing protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP15 PE=1 SV=1
5	AFDB:Q8GWW8	0.117	0.072	4.061E-1	456	0.122	0.055	Q8GWW8.pdb.gz	GFA2_ARATH Chaperone protein dnaJ GFA2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GFA2 PE=2 SV=1
6	AFDB:A0A178W725	0.145	0.142	6.070E-1	211	0.156	0.152	A0A178W725.pdb.gz	A0A178W725_ARATH CRR41 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45300 PE=1 SV=1
7	PDB:6w17H	0.169	0.243	6.969E-1	132	0.083	0.129	6w17H.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
8	AFDB:Q5A9B2	0.100	0.071	8.566E-1	355	0.098	0.056	Q5A9B2.pdb.gz	Q5A9B2_CANAL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACU1 PE=4 SV=1
9	AFDB:P0DMU9	0.182	0.192	9.072E-1	189	0.117	0.127	P0DMU9.pdb.gz	CT45A_HUMAN Cancer/testis antigen family 45 member A10 OS=Homo sapiens OX=9606 GN=CT45A10 PE=1 SV=1
10	AFDB:Q7XAK4	0.133	0.133	9.072E-1	212	0.137	0.132	Q7XAK4.pdb.gz	GID2_ORYSJ F-box protein GID2 OS=Oryza sativa subsp. japonica OX=39947 GN=GID2 PE=1 SV=1
11	AFDB:Q38874	0.136	0.087	9.608E-1	382	0.156	0.084	Q38874.pdb.gz	STM_ARATH Homeobox protein SHOOT MERISTEMLESS OS=Arabidopsis thaliana OX=3702 GN=STM PE=1 SV=2
12	PDB:6xywBn	0.159	0.274	1.311	100	0.059	0.120	6xywBn.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
13	PDB:7pntL	0.128	0.140	2.074	176	0.093	0.108	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:6s7oH	0.153	0.251	2.327	108	0.044	0.083	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
15	PDB:1cnt1	0.097	0.127	3.478	150	0.063	0.087	1cnt1.pdb.gz
16	PDB:4kxrA	0.169	0.328	3.901	85	0.054	0.129	4kxrA.pdb.gz
17	PDB:5apnh	0.121	0.180	4.376	119	0.068	0.118	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:2gbbA	0.135	0.165	4.908	156	0.088	0.115	2gbbA.pdb.gz
19	PDB:7ksrC	0.145	0.092	4.908	397	0.127	0.065	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
20	PDB:7z0lB	0.117	0.082	5.198	370	0.093	0.051	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYI0	6.79e-154	426	205	1.000	1.000	SHLD1_HUMAN Shieldin complex subunit 1 OS=Homo sapiens OX=9606 GN=SHLD1 PE=1 SV=1
2	Q9QZZ4	1.7	32.0	3511	0.098	0.006	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
3	C3KGP2	3.2	31.2	837	0.093	0.023	C3KGP2_DROME MIP04163p OS=Drosophila melanogaster OX=7227 GN=Mitf PE=2 SV=1
4	Q6WSQ9	3.2	31.2	730	0.093	0.026	Q6WSQ9_DROME MITF OS=Drosophila melanogaster OX=7227 GN=Mitf PE=2 SV=1
5	H9XVQ2	3.4	30.8	704	0.093	0.027	H9XVQ2_DROME Mitf, isoform D OS=Drosophila melanogaster OX=7227 GN=Mitf PE=4 SV=1
6	Q1RKN3	4.2	30.8	1919	0.185	0.020	TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tlh2 PE=2 SV=1
7	P0CT33	4.3	30.8	1887	0.185	0.020	TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tlh1 PE=3 SV=1
8	A0A384ME25	9.0	29.6	397	0.073	0.038	A0A384ME25_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15021 DUF4521	8.6e-105	360.6	Protein of unknown function (DUF4521)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305875

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298784	0.977	Protein FAM35A
2	9606.ENSP00000424007	0.910	CDNA FLJ26957 fis, clone SLV00486
3	9606.ENSP00000235310	0.899	Mitotic spindle assembly checkpoint protein MAD2B
4	9606.ENSP00000313759	0.666	CST complex subunit CTC1
5	9606.ENSP00000409231	0.636	Belongs to the TRAPPC13 family
6	9606.ENSP00000380762	0.603	CST complex subunit TEN1
7	9606.ENSP00000371475	0.594	TP53-binding protein 1
8	9606.ENSP00000368876	0.518	TOG array regulator of axonemal microtubules protein 2
9	9606.ENSP00000352642	0.516	Leucine-rich repeat-containing protein 61

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050871	0.977	positive regulation of B cell activation
GO:0002639	0.977	positive regulation of immunoglobulin production
GO:0010569	0.977	regulation of double-strand break repair via homologous recombination
GO:0045911	0.977	positive regulation of DNA recombination
GO:0045910	0.977	negative regulation of DNA recombination
GO:0002891	0.977	positive regulation of immunoglobulin mediated immune response
GO:2000781	0.970	positive regulation of double-strand break repair
GO:2001021	0.969	negative regulation of response to DNA damage stimulus
GO:0051094	0.964	positive regulation of developmental process
GO:0009987	0.455	cellular process
GO:2000042	0.380	negative regulation of double-strand break repair via homologous recombination
GO:0045830	0.380	positive regulation of isotype switching
GO:2001034	0.364	positive regulation of double-strand break repair via nonhomologous end joining

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035861	0.997	site of double-strand break
GO:0031981	0.955	nuclear lumen
GO:0005654	0.876	nucleoplasm
GO:0005829	0.664	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]