StarFunc result for job id Q8IYM9

User Input

>input (498 residues)
MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQ
TRFQPGNLRPNRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCE
LSQEHQGHQTFRINEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIER
QKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRR
LRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW
VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYFSSGKYYWEVD
VSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYP
YFNPWNCLVPMTVCPPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYM9	1.000	1.000	1.535E-94	498	1.000	1.000	Q8IYM9.pdb.gz	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
2	AFDB:Q9BYJ4	0.781	0.796	9.539E-66	488	0.608	0.621	Q9BYJ4.pdb.gz	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
3	AFDB:Q8BGE7	0.723	0.737	2.035E-62	488	0.546	0.557	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
4	AFDB:Q9C030	0.744	0.758	3.763E-61	488	0.572	0.584	Q9C030.pdb.gz	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
5	AFDB:Q9C035	0.695	0.701	3.871E-59	493	0.544	0.550	Q9C035.pdb.gz	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
6	AFDB:Q5C8U3	0.691	0.670	5.456E-59	515	0.526	0.509	Q5C8U3.pdb.gz	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
7	AFDB:Q5D7I0	0.695	0.701	6.117E-59	494	0.526	0.530	Q5D7I0.pdb.gz	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
8	AFDB:Q587N6	0.639	0.642	1.215E-58	495	0.520	0.523	Q587N6.pdb.gz	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
9	AFDB:P15533	0.786	0.788	2.990E-53	496	0.430	0.431	P15533.pdb.gz	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
10	AFDB:Q62191	0.331	0.350	1.945E-47	470	0.394	0.417	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
11	PDB:4b3nA	0.333	0.298	1.055E-23	557	0.191	0.171	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
12	PDB:7y4sA	0.321	0.457	1.039E-18	343	0.157	0.227	7y4sA.pdb.gz
13	PDB:4tn3B	0.364	0.492	6.117E-14	362	0.199	0.273	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7z36B	0.251	0.272	9.939E-8	446	0.112	0.126	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:7ccbA	0.221	0.618	1.462E-6	164	0.058	0.177	7ccbA.pdb.gz
16	PDB:6swy1	0.214	0.199	2.863E-5	542	0.064	0.059	6swy1.pdb.gz
17	PDB:7nsba	0.207	0.184	4.035E-5	568	0.068	0.060	7nsba.pdb.gz
18	PDB:7nscA	0.260	0.443	1.008E-4	276	0.054	0.098	7nscA.pdb.gz
19	PDB:4r8pL	0.133	0.257	5.936E-4	254	0.040	0.079	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7jzvA	0.150	0.287	6.656E-4	253	0.050	0.099	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q587N6	0.0	519	495	0.524	0.527	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
2	Q8BGE7	0.0	528	488	0.548	0.559	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
3	Q8IYM9	0.0	1035	498	1.000	1.000	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
4	Q9BYJ4	0.0	566	488	0.608	0.621	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
5	Q9C030	0.0	555	488	0.576	0.588	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
6	Q9C035	0.0	528	493	0.550	0.556	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
7	Q0PF16	6.31e-180	516	497	0.524	0.525	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
8	Q5C8U3	7.85e-178	511	515	0.530	0.513	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
9	Q5C8U4	1.19e-177	510	515	0.530	0.513	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
10	Q5D7I0	2.36e-173	499	494	0.526	0.530	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
11	P15533	5.66e-130	388	496	0.436	0.438	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
12	P19474	7.73e-120	362	475	0.408	0.427	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
13	Q3U7K7	8.34e-111	338	462	0.390	0.420	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
14	Q62191	2.13e-110	337	470	0.394	0.417	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
15	Q6AZZ1	4.60e-92	290	485	0.359	0.369	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
16	Q5NCC9	1.06e-80	261	485	0.339	0.348	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
17	O00635	3.71e-76	248	465	0.337	0.361	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
18	Q99PQ1	1.73e-74	238	284	0.243	0.426	TR12A_MOUSE Tripartite motif-containing protein 12A OS=Mus musculus OX=10090 GN=Trim12a PE=2 SV=1
19	A0A1U9X8R9	1.72e-71	238	513	0.319	0.310	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
20	P14373	1.72e-71	238	513	0.319	0.310	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04423 Rad50_zn_hook	5.3e+02	11.8	Rad50 zinc hook motif
2	PF00622 SPRY	8.9e-05	34.0	SPRY domain
3	PF04564 U-box	16	17.1	U-box domain
4	PF15750 UBZ_FAAP20	30	15.9	Ubiquitin-binding zinc-finger
5	PF10372 YojJ	1.5e+02	13.9	Bacterial membrane-spanning protein N-terminus
6	PF00643 zf-B_box	3.1e-05	35.3	B-box zinc finger
7	PF00097 zf-C3HC4	1.8e-06	39.0	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	7.4e-05	33.8	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.046	24.9	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	1.6e-06	39.4	zinc finger of C3HC4-type, RING
11	PF11789 zf-Nse	11	17.4	Zinc-finger of the MIZ type in Nse subunit
12	PF16685 zf-RING_10	27	16.3	zinc RING finger of MSL2
13	PF13639 zf-RING_2	0.0048	28.5	Ring finger domain
14	PF14570 zf-RING_4	5.2e+02	11.8	RING/Ubox like zinc-binding domain
15	PF14634 zf-RING_5	0.0078	27.5	zinc-RING finger domain
16	PF14835 zf-RING_6	3.2	19.0	zf-RING of BARD1-type protein
17	PF13445 zf-RING_UBOX	5.3e-08	44.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377344	0.811	Probable ATP-dependent RNA helicase DDX60
2	9606.ENSP00000326247	0.809	Sterile alpha motif domain-containing protein 9-like
3	9606.ENSP00000359504	0.796	Guanylate-binding protein 1
4	9606.ENSP00000381601	0.775	Interferon-induced GTP-binding protein Mx1
5	9606.ENSP00000295756	0.771	T-cell receptor-associated transmembrane adapter 1
6	9606.ENSP00000342278	0.770	2'-5'-oligoadenylate synthase 2
7	9606.ENSP00000359787	0.758	Interferon-induced protein 44-like
8	9606.ENSP00000360883	0.738	Interferon-induced protein with tetratricopeptide repeats 3
9	9606.ENSP00000268058	0.733	Protein PML
10	9606.ENSP00000354394	0.726	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000354822	0.725	XIAP-associated factor 1
12	9606.ENSP00000359783	0.718	Interferon-induced protein 44
13	9606.ENSP00000369213	0.666	Probable ATP-dependent RNA helicase DDX58
14	9606.ENSP00000371471	0.648	Radical S-adenosyl methionine domain-containing protein 2
15	9606.ENSP00000378624	0.645	Probable E3 ubiquitin-protein ligase HERC4
16	9606.ENSP00000381717	0.636	Ubiquitin-conjugating enzyme E2 D2
17	9606.ENSP00000252593	0.630	Bone marrow stromal antigen 2
18	9606.ENSP00000360869	0.630	Interferon-induced protein with tetratricopeptide repeats 1
19	9606.ENSP00000258381	0.628	Sp110 nuclear body protein
20	9606.ENSP00000333657	0.624	Interferon-induced GTP-binding protein Mx2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0003824	0.976	catalytic activity
GO:0019899	0.945	enzyme binding
GO:0016740	0.931	transferase activity
GO:0003714	0.914	transcription corepressor activity
GO:0019900	0.877	kinase binding
GO:0140096	0.876	catalytic activity, acting on a protein
GO:0019901	0.850	protein kinase binding
GO:0030674	0.828	protein-macromolecule adaptor activity
GO:0003713	0.819	transcription coactivator activity
GO:0004842	0.799	ubiquitin-protein transferase activity
GO:0061630	0.336	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0009605	0.986	response to external stimulus
GO:0044419	0.985	biological process involved in interspecies interaction between organisms
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0009615	0.978	response to virus
GO:0048583	0.962	regulation of response to stimulus
GO:0051171	0.951	regulation of nitrogen compound metabolic process
GO:0031323	0.948	regulation of cellular metabolic process
GO:0048518	0.942	positive regulation of biological process
GO:0080090	0.941	regulation of primary metabolic process
GO:0010468	0.922	regulation of gene expression
GO:0023051	0.894	regulation of signaling
GO:0048522	0.887	positive regulation of cellular process
GO:0010646	0.882	regulation of cell communication
GO:0009889	0.882	regulation of biosynthetic process
GO:0051252	0.867	regulation of RNA metabolic process
GO:0031326	0.857	regulation of cellular biosynthetic process
GO:0065009	0.853	regulation of molecular function
GO:0010556	0.851	regulation of macromolecule biosynthetic process
GO:0006950	0.849	response to stress
GO:0009966	0.847	regulation of signal transduction
GO:2001141	0.838	regulation of RNA biosynthetic process
GO:0006355	0.817	regulation of DNA-templated transcription
GO:0043122	0.778	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044093	0.765	positive regulation of molecular function
GO:0009987	0.754	cellular process
GO:1902533	0.752	positive regulation of intracellular signal transduction
GO:0098542	0.746	defense response to other organism
GO:0043123	0.733	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051091	0.678	positive regulation of DNA-binding transcription factor activity
GO:0048519	0.669	negative regulation of biological process
GO:0051092	0.588	positive regulation of NF-kappaB transcription factor activity
GO:0071704	0.532	organic substance metabolic process
GO:0051607	0.529	defense response to virus
GO:0006807	0.513	nitrogen compound metabolic process
GO:0050792	0.496	regulation of viral process
GO:0044238	0.489	primary metabolic process
GO:1903900	0.471	regulation of viral life cycle
GO:0009893	0.437	positive regulation of metabolic process
GO:0043170	0.409	macromolecule metabolic process
GO:0010604	0.379	positive regulation of macromolecule metabolic process
GO:0006955	0.378	immune response
GO:0002682	0.375	regulation of immune system process
GO:0002831	0.371	regulation of response to biotic stimulus
GO:0048523	0.371	negative regulation of cellular process
GO:0045087	0.359	innate immune response
GO:0048525	0.352	negative regulation of viral process
GO:1901564	0.332	organonitrogen compound metabolic process
GO:0050776	0.328	regulation of immune response
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0031347	0.311	regulation of defense response
GO:0051716	0.307	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.973	cytosol
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0070013	0.881	intracellular organelle lumen
GO:0031981	0.787	nuclear lumen
GO:0005654	0.631	nucleoplasm
GO:0012505	0.386	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.931	Transferases.

[back to server]