StarFunc result for job id Q8IYS8

User Input

>input (172 residues)
MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCK
ADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRIS
SQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYS8	1.000	1.000	3.761E-24	172	1.000	1.000	Q8IYS8.pdb.gz	BD1L2_HUMAN Biorientation of chromosomes in cell division protein 1-like 2 OS=Homo sapiens OX=9606 GN=BOD1L2 PE=1 SV=2
2	AFDB:Q96IK1	0.765	0.714	1.257E-19	185	0.860	0.800	Q96IK1.pdb.gz	BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2
3	AFDB:A0A0B4KHZ9	0.561	0.092	7.826E-8	1151	0.308	0.046	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
4	AFDB:B3H615	0.156	0.117	5.085E-1	262	0.122	0.080	B3H615.pdb.gz	ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
5	AFDB:Q6PEY1	0.324	0.340	6.933E-1	159	0.134	0.145	Q6PEY1.pdb.gz	TMM88_HUMAN Transmembrane protein 88 OS=Homo sapiens OX=9606 GN=TMEM88 PE=1 SV=1
6	AFDB:Q9VEF5	0.166	0.089	1.139	433	0.134	0.053	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
7	AFDB:Q9VJY8	0.180	0.118	1.139	285	0.122	0.074	Q9VJY8.pdb.gz	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
8	AFDB:Q84K72	0.191	0.136	1.211	277	0.180	0.112	Q84K72.pdb.gz	Q84K72_ARATH Forkhead-associated domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g06510 PE=1 SV=1
9	AFDB:Q9D0N8	0.301	0.313	1.211	159	0.151	0.164	Q9D0N8.pdb.gz	TMM88_MOUSE Transmembrane protein 88 OS=Mus musculus OX=10090 GN=Tmem88 PE=1 SV=1
10	PDB:1jebA	0.138	0.162	1.401	142	0.099	0.120	1jebA.pdb.gz	The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function.
11	PDB:4wa6B	0.212	0.328	1.401	96	0.105	0.188	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
12	AFDB:Q4VBS0	0.183	0.139	1.459	250	0.116	0.080	Q4VBS0.pdb.gz	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
13	PDB:7vvuV	0.186	0.247	2.032	113	0.105	0.159	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
14	PDB:1u2mC	0.230	0.263	2.447	143	0.058	0.070	1u2mC.pdb.gz
15	PDB:2zdiB	0.174	0.230	3.550	106	0.076	0.123	2zdiB.pdb.gz
16	PDB:3vbbB	0.161	0.080	3.777	454	0.081	0.031	3vbbB.pdb.gz
17	PDB:4ke2A	0.185	0.170	3.777	196	0.076	0.066	4ke2A.pdb.gz
18	PDB:4qyzA	0.182	0.092	3.777	468	0.122	0.045	4qyzA.pdb.gz	Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
19	PDB:7ehlA	0.227	0.102	3.777	563	0.064	0.020	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
20	PDB:6so5C	0.232	0.263	4.019	144	0.099	0.118	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYS8	1.99e-123	346	172	1.000	1.000	BD1L2_HUMAN Biorientation of chromosomes in cell division protein 1-like 2 OS=Homo sapiens OX=9606 GN=BOD1L2 PE=1 SV=2
2	Q96IK1	2.57e-82	243	185	0.756	0.703	BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2
3	Q8NFC6	9.14e-49	171	3051	0.419	0.024	BD1L1_HUMAN Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2
4	Q9VAY4	1.08e-25	104	1109	0.279	0.043	Q9VAY4_DROME Biorientation defective 1, isoform A OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=2
5	Q8IMM6	1.31e-25	104	1150	0.279	0.042	Q8IMM6_DROME Biorientation defective 1, isoform B OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
6	A0A0B4KHZ9	1.32e-25	104	1151	0.279	0.042	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
7	D3ZGS3	2.3	31.2	902	0.099	0.019	OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL OS=Rattus norvegicus OX=10116 GN=Ocrl PE=1 SV=1
8	Q53EL9	5.1	30.0	994	0.122	0.021	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
9	A0A348AUV6	5.5	29.6	554	0.110	0.034	TPS1B_CAMHI Valerianol synthase TPS1B OS=Camellia hiemalis OX=1840584 GN=TPS1B PE=2 SV=1
10	A0A140KFG9	6.0	29.6	554	0.110	0.034	TPS1_CAMBE Hedycaryol synthase OS=Camellia brevistyla OX=296050 GN=TPS1 PE=1 SV=1
11	A0A167V661	6.0	29.6	554	0.110	0.034	TPS8_CAMSI Valerianol synthase TPS8 OS=Camellia sinensis OX=4442 GN=TPS8 PE=1 SV=2
12	A0A348AUV5	6.0	29.6	554	0.110	0.034	TPS1A_CAMHI Valerianol synthase TPS1A OS=Camellia hiemalis OX=1840584 GN=TPS1A PE=1 SV=1
13	A0A348AUV7	6.0	29.6	554	0.110	0.034	TPS1C_CAMHI Valerianol synthase TPS1C OS=Camellia hiemalis OX=1840584 GN=TPS1C PE=2 SV=1
14	A0A348AUV9	6.0	29.6	554	0.110	0.034	TPS1E_CAMHI Valerianol synthase TPS1E OS=Camellia hiemalis OX=1840584 GN=TPS1E PE=2 SV=1
15	A0A348AUW0	6.0	29.6	554	0.110	0.034	TPS1F_CAMHI Valerianol synthase TPS1F OS=Camellia hiemalis OX=1840584 GN=TPS1F PE=2 SV=1
16	Q9SN80	6.2	29.6	1011	0.122	0.021	Q9SN80_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.130 PE=1 SV=1
17	O77431	8.2	29.3	1082	0.093	0.015	O77431_DROME EG:118B3.2 protein OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=1
18	P31550	9.0	28.9	327	0.076	0.040	THIB_ECOLI Thiamine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=thiB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05205 COMPASS-Shg1	3.4e-14	64.7	COMPASS (Complex proteins associated with Set1p) component shg1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309644	0.729	Biorientation of chromosomes in cell division protein 1
2	9606.ENSP00000482195	0.664	Zinc finger CCHC-type containing 18
3	9606.ENSP00000440982	0.660	Ras GTPase-activating protein 4B
4	9606.ENSP00000262940	0.630	Ras GTPase-activating protein 4
5	9606.ENSP00000302530	0.587	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000261597	0.579	Kinetochore protein NDC80 homolog
7	9606.ENSP00000319417	0.560	Spindle and kinetochore-associated protein 3
8	9606.ENSP00000300093	0.558	Serine/threonine-protein kinase PLK1
9	9606.ENSP00000040738	0.557	Biorientation of chromosomes in cell division protein 1-like 1
10	9606.ENSP00000376522	0.557	Centrosomal protein 112
11	9606.ENSP00000483930	0.556	Protein FAM200B
12	9606.ENSP00000256442	0.550	G2/mitotic-specific cyclin-B1
13	9606.ENSP00000285116	0.550	Spindle and kinetochore-associated protein 1
14	9606.ENSP00000423505	0.549	Tetratricopeptide repeat domain containing
15	9606.ENSP00000333433	0.548	Spindle and kinetochore-associated protein 2
16	9606.ENSP00000287598	0.543	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
17	9606.ENSP00000265295	0.540	Protein Spindly
18	9606.ENSP00000355922	0.540	Centromere protein F
19	9606.ENSP00000411372	0.520	Protein FAM200A
20	9606.ENSP00000398617	0.519	Protein FAM71E2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.368	enzyme binding
GO:0098772	0.357	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0007049	0.985	cell cycle
GO:0022402	0.984	cell cycle process
GO:0048519	0.982	negative regulation of biological process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0098813	0.973	nuclear chromosome segregation
GO:0009892	0.972	negative regulation of metabolic process
GO:1903047	0.971	mitotic cell cycle process
GO:0051276	0.967	chromosome organization
GO:0051656	0.958	establishment of organelle localization
GO:0000819	0.955	sister chromatid segregation
GO:0010605	0.951	negative regulation of macromolecule metabolic process
GO:0051649	0.946	establishment of localization in cell
GO:0048523	0.939	negative regulation of cellular process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0080090	0.927	regulation of primary metabolic process
GO:0051310	0.918	metaphase plate congression
GO:0000070	0.913	mitotic sister chromatid segregation
GO:0007080	0.857	mitotic metaphase plate congression
GO:0051172	0.854	negative regulation of nitrogen compound metabolic process
GO:0043086	0.844	negative regulation of catalytic activity
GO:0031324	0.843	negative regulation of cellular metabolic process
GO:0033036	0.830	macromolecule localization
GO:0008104	0.738	protein localization
GO:0031400	0.633	negative regulation of protein modification process
GO:0034502	0.606	protein localization to chromosome
GO:0010563	0.606	negative regulation of phosphorus metabolic process
GO:0051346	0.530	negative regulation of hydrolase activity
GO:0045936	0.511	negative regulation of phosphate metabolic process
GO:0008608	0.509	attachment of spindle microtubules to kinetochore
GO:0007062	0.503	sister chromatid cohesion
GO:0051315	0.482	attachment of mitotic spindle microtubules to kinetochore
GO:0071459	0.457	protein localization to chromosome, centromeric region
GO:0035304	0.329	regulation of protein dephosphorylation
GO:0010921	0.328	regulation of phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0015630	0.997	microtubule cytoskeleton
GO:0000940	0.997	outer kinetochore
GO:0005819	0.992	spindle
GO:0048188	0.992	Set1C/COMPASS complex
GO:0000922	0.972	spindle pole
GO:0005737	0.861	cytoplasm
GO:0005874	0.860	microtubule
GO:0005815	0.773	microtubule organizing center
GO:0005813	0.706	centrosome
GO:0005876	0.631	spindle microtubule
GO:0005829	0.561	cytosol
GO:0012505	0.331	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]