StarFunc result for job id Q8IYT2

User Input

>input (770 residues)
MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEL
NAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHE
ILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEA
NDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFISSMATVHLVTADGSFDC
QGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHV
FKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRH
EECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV
KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS
ILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPK
QQYSCSCHVFSEELIFSELCSLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVR
LLESAELTTFSCSLLHDGDPTYQRLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF
VLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFRYLQSVNELLSTLLNSDSPQQ
VLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYT2	1.000	1.000	0.000	770	1.000	1.000	Q8IYT2.pdb.gz	CMTR2_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Homo sapiens OX=9606 GN=CMTR2 PE=1 SV=2
2	AFDB:Q9UAS6	0.735	0.805	7.997E-43	700	0.286	0.314	Q9UAS6.pdb.gz	CMTR2_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=cmtr2 PE=2 SV=2
3	AFDB:Q9W4N2	0.408	0.400	5.960E-17	788	0.105	0.103	Q9W4N2.pdb.gz	CMTR1_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Cmtr1 PE=1 SV=1
4	AFDB:Q38AH0	0.386	0.770	1.518E-16	370	0.104	0.216	Q38AH0.pdb.gz	MTR1_TRYB2 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=MTR1 PE=1 SV=1
5	AFDB:Q8N1G2	0.372	0.345	6.321E-16	835	0.127	0.117	Q8N1G2.pdb.gz	CMTR1_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=CMTR1 PE=1 SV=1
6	AFDB:Q586Q7	0.195	0.168	1.115E-7	905	0.099	0.084	Q586Q7.pdb.gz	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
7	AFDB:Q8IY81	0.202	0.185	1.426E-7	847	0.105	0.096	Q8IY81.pdb.gz	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
8	AFDB:Q9UET6	0.218	0.475	1.916E-7	329	0.070	0.164	Q9UET6.pdb.gz	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
9	AFDB:P38238	0.215	0.489	3.292E-7	310	0.062	0.155	P38238.pdb.gz	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
10	AFDB:O42832	0.196	0.188	4.008E-7	802	0.106	0.102	O42832.pdb.gz	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
11	PDB:6elzw	0.212	0.359	6.989E-7	436	0.095	0.167	6elzw.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
12	PDB:6jplB	0.207	0.615	1.036E-6	231	0.064	0.212	6jplB.pdb.gz	Structure of tRNA methyltransferase complex of Trm7 and Trm734 reveals a novel binding interface for tRNA recognition.
13	PDB:7nacw	0.183	0.208	1.099E-5	672	0.078	0.089	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:7o9mn	0.218	0.703	3.578E-5	215	0.049	0.177	7o9mn.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:6u1xA	0.199	0.080	5.570E-5	2059	0.055	0.020	6u1xA.pdb.gz	Structure of the Vesicular Stomatitis Virus L Protein in Complex with Its Phosphoprotein Cofactor.
16	PDB:6ylxw	0.197	0.396	7.860E-5	360	0.051	0.108	6ylxw.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
17	PDB:6rieL	0.181	0.428	1.298E-3	287	0.040	0.108	6rieL.pdb.gz	Structural Basis of Poxvirus Transcription: Transcribing and Capping Vaccinia Complexes.
18	PDB:5a22A	0.181	0.076	2.021E-3	2002	0.036	0.014	5a22A.pdb.gz	Structure of the L Protein of Vesicular Stomatitis Virus from Electron Cryomicroscopy.
19	PDB:1ej6A	0.191	0.124	2.460E-3	1284	0.051	0.030	1ej6A.pdb.gz	Structure of the reovirus core at 3.6 A resolution.
20	PDB:1yaaA	0.137	0.219	4.226E-3	412	0.053	0.100	1yaaA.pdb.gz	Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYT2	0.0	1599	770	1.000	1.000	CMTR2_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Homo sapiens OX=9606 GN=CMTR2 PE=1 SV=2
2	Q9UAS6	3.32e-88	295	700	0.219	0.241	CMTR2_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=cmtr2 PE=2 SV=2
3	Q8N1G2	2.98e-17	89.0	835	0.057	0.053	CMTR1_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=CMTR1 PE=1 SV=1
4	Q9W4N2	2.19e-16	85.9	788	0.061	0.060	CMTR1_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Cmtr1 PE=1 SV=1
5	Q38AH0	4.21e-11	67.8	370	0.088	0.184	MTR1_TRYB2 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=MTR1 PE=1 SV=1
6	Q5T7F5	8.36e-10	63.9	372	0.040	0.083	Q5T7F5_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=CMTR1 PE=1 SV=1
7	F4JTD2	2.68e-05	50.1	821	0.042	0.039	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
8	Q586Q7	2.78e-04	47.0	905	0.045	0.039	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
9	O42832	4.94e-04	46.2	802	0.034	0.032	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
10	O36015	0.003	42.7	285	0.040	0.109	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
11	Q9UET6	0.005	42.0	329	0.053	0.125	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
12	P38238	0.011	41.2	310	0.055	0.135	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
13	Q9VEP1	0.022	40.0	302	0.068	0.172	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
14	P25582	0.049	39.7	841	0.026	0.024	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
15	Q8IY81	0.093	38.9	847	0.022	0.020	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
16	Q6FVB8	0.12	38.1	501	0.051	0.078	Q6FVB8_CANGA Cystathionine beta-synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CYS4 PE=3 SV=1
17	O01592	0.13	37.7	337	0.023	0.053	CYSK3_CAEEL Cysteine synthase 3 OS=Caenorhabditis elegans OX=6239 GN=cysl-3 PE=1 SV=1
18	P78860	0.14	37.0	218	0.036	0.128	MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm2 PE=2 SV=2
19	P53123	0.36	36.2	320	0.034	0.081	MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM2 PE=1 SV=1
20	Q9VDD9	1.2	34.7	320	0.032	0.078	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	9.6e-28	109.0	FtsJ-like methyltransferase
2	PF00605 IRF	3.1e+02	13.0	Interferon regulatory factor transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362550	0.940	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
2	9606.ENSP00000260129	0.750	Trimethylguanosine synthase
3	9606.ENSP00000298299	0.744	Zinc finger protein 22
4	9606.ENSP00000358497	0.718	mRNA-capping enzyme
5	9606.ENSP00000307181	0.715	RNMT-activating mini protein
6	9606.ENSP00000372804	0.671	mRNA cap guanine-N7 methyltransferase
7	9606.ENSP00000274695	0.640	Threonylcarbamoyladenosine tRNA methylthiotransferase
8	9606.ENSP00000356433	0.640	Uronyl 2-sulfotransferase
9	9606.ENSP00000374387	0.621	Probable tRNA (uracil-O(2)-)-methyltransferase
10	9606.ENSP00000309126	0.568	Probable 28S rRNA (cytosine-C(5))-methyltransferase
11	9606.ENSP00000242257	0.567	rRNA methyltransferase 2, mitochondrial
12	9606.ENSP00000426455	0.564	Ribonuclease T2
13	9606.ENSP00000261800	0.538	Protocadherin Fat 2
14	9606.ENSP00000396673	0.522	pre-rRNA processing protein FTSJ3
15	9606.ENSP00000358451	0.520	Ganglioside induced differentiation associated protein 2
16	9606.ENSP00000353246	0.510	Protein MAK16 homolog
17	9606.ENSP00000264670	0.507	tRNA (cytosine(34)-C(5))-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004483	1.000	mRNA (nucleoside-2'-O-)-methyltransferase activity
GO:0005488	0.528	binding
GO:0005515	0.450	protein binding
GO:0097159	0.326	organic cyclic compound binding
GO:1901363	0.325	heterocyclic compound binding
GO:0003676	0.324	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0036260	0.991	RNA capping
GO:0006397	0.990	mRNA processing
GO:0044260	0.910	cellular macromolecule metabolic process
GO:0032259	0.907	methylation
GO:0016556	0.850	mRNA modification
GO:0043414	0.848	macromolecule methylation
GO:0001510	0.844	RNA methylation
GO:0050789	0.382	regulation of biological process
GO:0050794	0.373	regulation of cellular process
GO:0006370	0.368	7-methylguanosine mRNA capping
GO:0080009	0.365	mRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.543	intracellular organelle lumen
GO:0031981	0.465	nuclear lumen
GO:0005654	0.448	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.57	1.000	methyltransferase cap1.

[back to server]