StarFunc result for job id Q8IYT8

User Input

>input (1036 residues)
MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSCPVPVPMYSGSVSGSSCGSSP
SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDTDDFVLVPHNI
SSDHSCDMPVGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST
ASSGTNVHGSPRSAVVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPAEEQSKDGNEPRECAHCLLVQGSERQRAEQQS
KAVFGRSVSTGKLSDQQGKTPICRHQGSTDSLNTERPMDIAPAGACGGVLAPPAGTAASS
KAVLFTVGSPPHSAAAPTCTHMFLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSS
PPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECV
LDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLH
LAKAQIKSGKLSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVT
AEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKC
SIERRLSALCHSTATV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QY01	0.714	0.714	0.000	1037	0.937	0.936	Q9QY01.pdb.gz	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1
2	AFDB:X1WEA3	0.600	0.601	1.250E-100	1034	0.751	0.752	X1WEA3.pdb.gz	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1
3	AFDB:O75385	0.338	0.334	2.661E-76	1050	0.531	0.524	O75385.pdb.gz	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2
4	AFDB:D3ZMG0	0.491	0.486	3.962E-75	1051	0.533	0.525	D3ZMG0.pdb.gz	D3ZMG0_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=1 SV=3
5	AFDB:Q9W179	0.244	0.151	4.507E-21	1703	0.179	0.109	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
6	AFDB:Q9TW45	0.242	0.210	6.853E-21	1192	0.190	0.165	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
7	AFDB:O08815	0.236	0.205	2.771E-20	1206	0.165	0.142	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
8	AFDB:Q0WPH8	0.243	0.262	2.771E-20	956	0.176	0.190	Q0WPH8.pdb.gz	NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana OX=3702 GN=NEK5 PE=1 SV=1
9	PDB:6b1uA	0.241	0.554	6.414E-19	442	0.087	0.204	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
10	PDB:4zhxA	0.240	0.593	1.872E-18	409	0.087	0.220	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
11	PDB:4rerA	0.243	0.541	2.152E-18	459	0.083	0.187	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	PDB:5ufuA	0.238	0.648	3.273E-18	369	0.084	0.236	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
13	PDB:7myjC	0.240	0.523	3.943E-18	465	0.089	0.198	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:5u6yA	0.233	0.513	6.894E-18	459	0.087	0.196	5u6yA.pdb.gz
15	PDB:6byrA	0.240	0.599	9.551E-18	405	0.078	0.200	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
16	PDB:4krcA	0.228	0.748	1.098E-17	297	0.077	0.269	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	AFDB:P42684	0.230	0.203	1.633E-17	1182	0.167	0.146	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
18	PDB:4rewA	0.243	0.598	1.670E-17	411	0.086	0.217	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	AFDB:O76039	0.221	0.238	5.232E-17	960	0.184	0.199	O76039.pdb.gz	CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=2
20	PDB:2yaaA	0.236	0.778	6.151E-17	300	0.077	0.267	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GA79	0.0	885	1014	0.542	0.553	A0A8I6GA79_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=4 SV=1
2	D3ZMG0	0.0	885	1057	0.544	0.534	D3ZMG0_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=1 SV=3
3	O70405	0.0	894	1051	0.544	0.537	ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus OX=10090 GN=Ulk1 PE=1 SV=1
4	O75385	0.0	906	1050	0.542	0.535	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2
5	Q8IYT8	0.0	2143	1036	1.000	1.000	ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens OX=9606 GN=ULK2 PE=1 SV=3
6	Q9QY01	0.0	1922	1037	0.937	0.936	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1
7	X1WEA3	0.0	1492	1034	0.747	0.749	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1
8	Q9VU14	1.68e-106	353	835	0.197	0.244	Q9VU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=2 SV=1
9	Q23023	4.55e-105	350	856	0.206	0.249	UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans OX=6239 GN=unc-51 PE=1 SV=1
10	Q8MQJ7	3.59e-104	348	855	0.198	0.240	Q8MQJ7_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=1 SV=1
11	Q94C95	4.67e-63	228	626	0.118	0.195	ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1
12	Q6PHR2	9.93e-55	200	472	0.107	0.235	ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens OX=9606 GN=ULK3 PE=1 SV=2
13	Q4WPF2	1.37e-54	208	973	0.119	0.126	ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=atg1 PE=3 SV=1
14	A2QIL5	2.36e-54	208	1007	0.115	0.118	ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=atg1 PE=3 SV=1
15	Q9Y7T4	1.17e-53	204	830	0.111	0.139	ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg1 PE=1 SV=1
16	Q9VHF6	4.38e-53	196	520	0.098	0.196	Q9VHF6_DROME Serine/threonine-protein kinase ULK3 OS=Drosophila melanogaster OX=7227 GN=Aduk PE=4 SV=1
17	Q52EB3	1.80e-52	202	982	0.118	0.124	ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=ATG1 PE=1 SV=1
18	Q86CS2	2.08e-52	198	668	0.110	0.171	ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum OX=44689 GN=atg1 PE=3 SV=1
19	Q55FT4	3.27e-47	187	2247	0.109	0.050	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
20	Q6CSX2	9.93e-47	183	831	0.102	0.128	ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ATG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0096	26.6	ABC1 atypical kinase-like domain
2	PF01636 APH	66	14.8	Phosphotransferase enzyme family
3	PF12063 DUF3543	5e-18	77.0	Domain of unknown function (DUF3543)
4	PF19250 DUF5898	5.2e+02	12.0	Family of unknown function (DUF5898)
5	PF06293 Kdo	0.00031	31.7	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	71	14.2	Kinase-like
7	PF00069 Pkinase	1.5e-65	232.8	Protein kinase domain
8	PF17667 Pkinase_fungal	0.31	21.4	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	1.7e-45	166.9	Protein tyrosine and serine/threonine kinase
10	PF01163 RIO1	0.059	24.5	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378914

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000025008	0.999	RB1-inducible coiled-coil protein 1
2	9606.ENSP00000432412	0.999	Autophagy-related protein 13
3	9606.ENSP00000354558	0.993	Serine/threonine-protein kinase mTOR
4	9606.ENSP00000338990	0.985	Autophagy-related protein 101
5	9606.ENSP00000355231	0.977	Beclin-1
6	9606.ENSP00000247178	0.970	Beclin 1-associated autophagy-related key regulator
7	9606.ENSP00000307272	0.966	Regulatory-associated protein of mTOR
8	9606.ENSP00000262039	0.961	Phosphatidylinositol 3-kinase catalytic subunit type 3
9	9606.ENSP00000366475	0.943	Autophagy-related protein 2 homolog A
10	9606.ENSP00000456405	0.943	Target of rapamycin complex subunit LST8
11	9606.ENSP00000353010	0.942	Autophagy-related protein 2 homolog B
12	9606.ENSP00000324560	0.922	Serine/threonine-protein kinase ULK1
13	9606.ENSP00000349205	0.920	Phosphoinositide 3-kinase regulatory subunit 4
14	9606.ENSP00000346437	0.884	Ubiquitin-like modifier-activating enzyme ATG7
15	9606.ENSP00000266458	0.881	Gamma-aminobutyric acid receptor-associated protein-like 1
16	9606.ENSP00000283290	0.870	Ubiquitin-like-conjugating enzyme ATG3
17	9606.ENSP00000358072	0.861	Autophagy protein 5
18	9606.ENSP00000306866	0.860	Gamma-aminobutyric acid receptor-associated protein
19	9606.ENSP00000403636	0.856	Ras/Rap GTPase-activating protein SynGAP
20	9606.ENSP00000384259	0.852	Cysteine protease ATG4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.403	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.993	cellular metabolic process
GO:0016043	0.988	cellular component organization
GO:0050794	0.987	regulation of cellular process
GO:0051128	0.959	regulation of cellular component organization
GO:0061919	0.934	process utilizing autophagic mechanism
GO:0071704	0.840	organic substance metabolic process
GO:0032501	0.830	multicellular organismal process
GO:0050896	0.826	response to stimulus
GO:0044238	0.821	primary metabolic process
GO:0009056	0.814	catabolic process
GO:0036211	0.797	protein modification process
GO:0016310	0.752	phosphorylation
GO:0006914	0.749	autophagy
GO:0019222	0.717	regulation of metabolic process
GO:0048856	0.711	anatomical structure development
GO:0048518	0.701	positive regulation of biological process
GO:0007275	0.652	multicellular organism development
GO:0048522	0.628	positive regulation of cellular process
GO:0048519	0.624	negative regulation of biological process
GO:0048523	0.603	negative regulation of cellular process
GO:0050793	0.596	regulation of developmental process
GO:0006468	0.586	protein phosphorylation
GO:0031323	0.583	regulation of cellular metabolic process
GO:0030154	0.557	cell differentiation
GO:0048468	0.554	cell development
GO:0030030	0.548	cell projection organization
GO:0007399	0.543	nervous system development
GO:0120036	0.516	plasma membrane bounded cell projection organization
GO:0006950	0.475	response to stress
GO:0051716	0.457	cellular response to stimulus
GO:0031344	0.443	regulation of cell projection organization
GO:0031175	0.428	neuron projection development
GO:0065008	0.404	regulation of biological quality
GO:0120035	0.395	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.382	regulation of neuron projection development
GO:0006996	0.364	organelle organization
GO:0031329	0.357	regulation of cellular catabolic process
GO:0010506	0.352	regulation of autophagy
GO:0016236	0.345	macroautophagy
GO:0009653	0.341	anatomical structure morphogenesis
GO:0007154	0.325	cell communication
GO:0033554	0.310	cellular response to stress
GO:0060255	0.308	regulation of macromolecule metabolic process
GO:0009605	0.301	response to external stimulus
GO:0051179	0.300	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.974	membrane
GO:0000407	0.948	phagophore assembly site
GO:0005829	0.884	cytosol
GO:0043227	0.846	membrane-bounded organelle
GO:0032991	0.824	protein-containing complex
GO:1990234	0.709	transferase complex
GO:0061695	0.689	transferase complex, transferring phosphorus-containing groups
GO:0043229	0.445	intracellular organelle
GO:1902554	0.407	serine/threonine protein kinase complex
GO:0043231	0.404	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]