StarFunc result for job id Q8IYU8

User Input

>input (434 residues)
MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAA
RDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMER
KTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVA
FKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFG
KRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYW
KNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQ
ELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK
GVKEVWKQAGKGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYU8	1.000	1.000	1.293E-65	434	1.000	1.000	Q8IYU8.pdb.gz	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
2	AFDB:Q8CD10	0.707	0.710	1.082E-49	432	0.857	0.861	Q8CD10.pdb.gz	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
3	PDB:6iihA	0.619	0.603	5.472E-36	446	0.650	0.632	6iihA.pdb.gz	The crystal structure of MICU2 provides insight into Ca2+binding and MICU1-MICU2 heterodimer formation.
4	AFDB:Q86XE3	0.668	0.552	7.461E-27	530	0.373	0.306	Q86XE3.pdb.gz	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
5	AFDB:A2VEI2	0.539	0.454	1.903E-18	525	0.247	0.204	A2VEI2.pdb.gz	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
6	AFDB:A0A286YF11	0.570	0.519	4.488E-18	482	0.244	0.220	A0A286YF11.pdb.gz	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
7	AFDB:Q9SZ45	0.483	0.430	2.428E-15	498	0.253	0.221	Q9SZ45.pdb.gz	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
8	PDB:6xjxQ	0.509	0.590	1.406E-14	367	0.198	0.234	6xjxQ.pdb.gz
9	AFDB:Q581Z7	0.528	0.556	2.996E-13	410	0.175	0.185	Q581Z7.pdb.gz	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
10	PDB:6k7yI	0.494	0.684	5.992E-12	306	0.184	0.261	6k7yI.pdb.gz	Structure of intact human MCU supercomplex with the auxiliary MICU subunits.
11	AFDB:Q4QIT3	0.520	0.635	2.086E-11	345	0.164	0.206	Q4QIT3.pdb.gz	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
12	PDB:2n6aA	0.128	0.294	4.300E-2	162	0.069	0.185	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
13	PDB:1ggzA	0.128	0.340	4.510E-2	144	0.071	0.215	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
14	PDB:5a2hA	0.125	0.327	4.731E-2	147	0.058	0.170	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:7u0tA	0.119	0.224	4.731E-2	190	0.097	0.221	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
16	PDB:2f2pA	0.129	0.279	5.725E-2	169	0.067	0.172	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
17	AFDB:Q3USB7	0.139	0.070	5.769E-2	1096	0.127	0.050	Q3USB7.pdb.gz	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
18	PDB:1a2xA	0.129	0.299	6.605E-2	158	0.058	0.158	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
19	PDB:1s1eA	0.129	0.257	6.927E-2	181	0.055	0.133	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
20	AFDB:Q4KWH8	0.147	0.047	2.192E-1	1693	0.058	0.015	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CD10	0.0	729	432	0.859	0.863	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
2	Q8IYU8	0.0	901	434	1.000	1.000	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
3	Q86XE3	8.26e-91	286	530	0.355	0.291	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
4	A0A0S2Z6B0	1.37e-80	246	124	0.274	0.960	A0A0S2Z6B0_HUMAN EF-hand domain family member A1 isoform 2 OS=Homo sapiens OX=9606 GN=EFHA1 PE=1 SV=1
5	A0A0U1RRK1	2.05e-34	135	480	0.210	0.190	A0A0U1RRK1_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
6	A0A286YF11	4.05e-34	135	482	0.212	0.191	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
7	Q9BPX6	4.44e-34	134	476	0.203	0.185	MICU1_HUMAN Calcium uptake protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
8	Q8VCX5	5.65e-34	134	477	0.203	0.184	MICU1_MOUSE Calcium uptake protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Micu1 PE=1 SV=1
9	A2VEI2	6.50e-30	123	525	0.212	0.175	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
10	Q9SZ45	2.81e-29	121	498	0.249	0.217	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
11	Q4QIT3	1.19e-15	80.1	345	0.159	0.200	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
12	Q581Z7	9.75e-13	71.6	410	0.157	0.166	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
13	O75746	1.22e-09	62.8	678	0.166	0.106	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
14	F1LX07	3.57e-09	61.2	676	0.164	0.105	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
15	Q8BH59	4.11e-09	60.8	677	0.150	0.096	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
16	Q9VA73	9.03e-08	56.6	695	0.136	0.085	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
17	Q9QXX4	3.83e-07	54.7	676	0.106	0.068	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
18	Q9UJS0	1.22e-06	53.1	675	0.101	0.065	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
19	Q9ES45	0.055	38.5	1517	0.062	0.018	DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus OX=10116 GN=Duox2 PE=2 SV=1
20	Q99653	0.057	37.4	195	0.058	0.128	CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	1.9e-05	34.9	EF hand
2	PF12763 EF-hand_4	1.6e+02	13.6	Cytoskeletal-regulatory complex EF hand
3	PF13202 EF-hand_5	5.3e+02	11.6	EF hand
4	PF13405 EF-hand_6	4.4e-05	34.0	EF-hand domain
5	PF13499 EF-hand_7	1.3e-09	49.7	EF-hand domain pair
6	PF13833 EF-hand_8	0.003	28.6	EF-hand domain pair
7	PF06252 GemA	4.3e+02	13.3	Bacteriophage Mu, GemA protein
8	PF10591 SPARC_Ca_bdg	2.5e+02	13.4	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371811

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327467	0.999	Essential MCU regulator, mitochondrial
2	9606.ENSP00000362144	0.999	Calcium uniporter protein, mitochondrial
3	9606.ENSP00000354415	0.998	Calcium uptake protein 1, mitochondrial
4	9606.ENSP00000378145	0.997	Calcium uniporter regulatory subunit MCUb, mitochondrial
5	9606.ENSP00000368468	0.959	Mitochondrial calcium uniporter regulator 1
6	9606.ENSP00000180166	0.920	Fibroblast growth factor 20
7	9606.ENSP00000371790	0.786	Fibroblast growth factor 9
8	9606.ENSP00000447091	0.773	Mitochondrial sodium/calcium exchanger protein
9	9606.ENSP00000301454	0.766	Calcium-binding mitochondrial carrier protein SCaMC-3
10	9606.ENSP00000268704	0.748	Paraplegin
11	9606.ENSP00000305653	0.743	Mitochondrial proton/calcium exchanger protein
12	9606.ENSP00000269143	0.742	AFG3-like protein 2
13	9606.ENSP00000371905	0.717	Probable palmitoyltransferase ZDHHC20
14	9606.ENSP00000295767	0.692	Mitochondrial intermembrane space import and assembly protein 40
15	9606.ENSP00000441875	0.692	Prohibitin-2
16	9606.ENSP00000295079	0.677	m-AAA protease-interacting protein 1, mitochondrial
17	9606.ENSP00000362465	0.673	Palmitoyltransferase ZDHHC15
18	9606.ENSP00000479488	0.662	Prohibitin
19	9606.ENSP00000373713	0.655	Phosphatidylinositide phosphatase SAC1
20	9606.ENSP00000378265	0.649	Sodium/hydrogen exchanger 9B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0005509	0.727	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:1990542	0.980	mitochondrial transmembrane transport
GO:0006874	0.979	intracellular calcium ion homeostasis
GO:0006816	0.974	calcium ion transport
GO:0051560	0.966	mitochondrial calcium ion homeostasis
GO:0070588	0.960	calcium ion transmembrane transport
GO:0006851	0.385	mitochondrial calcium ion transmembrane transport
GO:0065007	0.345	biological regulation
GO:0050789	0.335	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0034704	0.998	calcium channel complex
GO:0070013	0.993	intracellular organelle lumen
GO:0031090	0.931	organelle membrane
GO:0031966	0.914	mitochondrial membrane
GO:0005743	0.904	mitochondrial inner membrane
GO:0098798	0.845	mitochondrial protein-containing complex
GO:0098800	0.610	inner mitochondrial membrane protein complex
GO:0031970	0.390	organelle envelope lumen
GO:0005758	0.375	mitochondrial intermembrane space
GO:0031981	0.353	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]