StarFunc result for job id Q8IYW2

User Input

>input (1400 residues)
MDLVITQELARAESQQDAASLKKAYELIKSANLGKSEFDPSESFSPDLFVLCAEQALKMR
QPEVSEDCIQMYFKVKAPITQFLGRAHLCRAQMCAPKSAENLEEFENCVTEYMKAINFAK
GEPRYYFLVYNASVLYWQMVRPFLKPGYRHHLIPSLSQIINVLSQTEEEDKEWRAELMLE
LLECYLQAGRKEEAARFCSTAAPFIKSHVPQKYRQIFSVMVRHELMDELQLKEEKKNSIS
LSVTFYINMLKAKAEQNDLPGDISVILRKAYRHLGHYNHQRFPSISEEKMLLLFELARFS
LTLKCMEISSACLSDLKKMESKDPGKLIEMECLECESEALRLESKMKVYNRAAVEAQLDI
IQRLDVALQRAVRLGDPRVIHVVCATQWNTCLPLLQHNLRHHLRKPLAGVADVLEKLDSL
MTLLRCQVHMEMAQIEEDEDRLEPATEHLRKAARLDSLGLYRDRIQMASTRLRLCTTLYQ
APERAEDKAIMAVEQAKKATPKDSVRKKRALLVNAGLALAPDAFQIVLDSENEAKVSTGK
NRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQGVWDVCRTA
SRFCLLYDNVKVKKLRLRRGKKKRGRDGSVQDTWSQPEVVLQRQVCPDLLRKFAEVGFIH
AEATVHLLRSEGVELNDRAIPPEDLSQHPAGYVPEPPEVNAEWITYRTWIESLSRCAMNN
WLRSAEIGQEIQEAWIVQNAVVYVLNHNHHLILAGRQKELVDALYHLLSIVKATGHSGDP
VMLVTLCNTLARGLIISWIPVQAAEKSRKFMRPNAFHSPLDAGATSEIKTAVEVCEFALN
LTNGSAPEETVPTGTRQQLIATWVKAKQLLQQQIGPRLGTEEQGTNEDVSSVTRVLVALE
MYSCNGLGLMDFTVPSLAQLVKMASECNWSDPLVELQTLTRLTHFAHAARDHETTMACAH
RALEMGIKYLKKFGPEESRLVAEMLCTATAIQGRSIMENLKGRKQLRLVAAKAFTESARF
GGIAGSSALVMLAARHYWNAWLPLLSSAVYRKKAKGALKRLIGIINKTEARKQEKGKTLL
LHQWPTADFQGGGTTEGYFLPGAEDDLALRAALYGLLFHSHADQDDWEGGLKVLDEAVQV
LPRTAHRLLIFKHMVIVKAKLGQNFSMEIQKFKAESEDYLARMWHRLALNSPSVSGELAC
YNNAIQALQKPEMEWQKVEYLMEFGQWLHHRHFPLEDVVFHLRWAVEILLAMKPPGDVPE
PQPTPDGEYVAVEMPPRSPVSEAEEAVSLEQLRSVRQLEALARVHILLALVLSPGAEGYE
DCCLAAYAFFRHIWQVSLMTAGKSVLENRPLAATSSHLLLPKKEKENERSKEKEKERSKE
KENERSKEKDKEKGKEEKVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7sqcR1	0.533	0.382	6.759E-27	2080	0.173	0.116	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
2	AFDB:Q57ZZ0	0.492	0.304	5.460E-24	2503	0.167	0.093	Q57ZZ0.pdb.gz	Q57ZZ0_TRYB2 Separase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.1130 PE=4 SV=1
3	PDB:7n6g1N	0.502	0.348	2.127E-23	2179	0.166	0.106	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
4	AFDB:Q6PGP7	0.129	0.118	7.153E-11	1564	0.119	0.107	Q6PGP7.pdb.gz	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
5	PDB:4bujB	0.142	0.145	3.203E-10	1367	0.112	0.115	4bujB.pdb.gz
6	AFDB:Q96AY4	0.165	0.116	2.468E-9	2481	0.111	0.063	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
7	AFDB:P17883	0.127	0.125	5.879E-9	1432	0.111	0.108	P17883.pdb.gz	SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI3 PE=1 SV=2
8	PDB:7dkhI	0.133	0.186	1.735E-8	914	0.087	0.133	7dkhI.pdb.gz
9	PDB:7qdrB	0.141	0.158	4.280E-8	1212	0.115	0.133	7qdrB.pdb.gz
10	AFDB:Q38CC3	0.104	0.087	7.160E-8	1747	0.106	0.085	Q38CC3.pdb.gz	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
11	AFDB:P89105	0.131	0.159	7.946E-8	1077	0.099	0.128	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
12	AFDB:Q8NDW8	0.168	0.175	2.773E-7	1320	0.108	0.114	Q8NDW8.pdb.gz	TT21A_HUMAN Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3
13	AFDB:Q8IYF3	0.133	0.181	5.003E-7	940	0.097	0.145	Q8IYF3.pdb.gz	TEX11_HUMAN Testis-expressed protein 11 OS=Homo sapiens OX=9606 GN=TEX11 PE=1 SV=3
14	AFDB:F4I3Z5	0.142	0.160	5.748E-7	1168	0.115	0.138	F4I3Z5.pdb.gz	SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana OX=3702 GN=SKI3 PE=1 SV=1
15	AFDB:Q14AT2	0.172	0.235	2.150E-6	947	0.085	0.126	Q14AT2.pdb.gz	TEX11_MOUSE Testis-expressed protein 11 OS=Mus musculus OX=10090 GN=Tex11 PE=1 SV=1
16	PDB:4xnhA	0.136	0.212	2.824E-5	786	0.067	0.120	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
17	PDB:6bcuA	0.118	0.092	3.134E-5	2204	0.148	0.094	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
18	PDB:6tedQ	0.202	0.276	3.245E-5	890	0.097	0.153	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:6c95A	0.139	0.222	3.601E-5	773	0.084	0.151	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
20	PDB:7sukSP	0.132	0.095	5.655E-5	2234	0.127	0.080	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8ICS9	1.19e-15	85.5	2784	0.041	0.021	CFA46_CHLRE Cilia- and flagella-associated protein 46 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP46 PE=1 SV=1
2	Q57ZZ0	0.007	43.5	2503	0.019	0.010	Q57ZZ0_TRYB2 Separase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.1130 PE=4 SV=1
3	Q5HZG4	0.23	38.5	932	0.011	0.017	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
4	P23470	1.2	36.2	1445	0.019	0.019	PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4
5	Q6PGZ3	2.5	35.0	629	0.012	0.027	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
6	A8J666	2.6	35.0	3081	0.011	0.005	CFA54_CHLRE Cilia- and flagella-associated protein 54 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP54 PE=1 SV=1
7	P34078	2.6	34.7	463	0.014	0.043	LTV1_YEAST Protein LTV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LTV1 PE=1 SV=2
8	Q54CF8	2.6	35.0	3071	0.013	0.006	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
9	Q8BSE0	4.2	33.9	410	0.026	0.090	RMD2_MOUSE Regulator of microtubule dynamics protein 2 OS=Mus musculus OX=10090 GN=Rmdn2 PE=1 SV=1
10	Q62839	4.7	34.3	998	0.021	0.030	GOGA2_RAT Golgin subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=4
11	A0A8I5ZUN3	5.9	33.9	35375	0.024	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
12	F4JQG2	6.6	33.5	551	0.011	0.027	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
13	O23212	6.6	33.5	573	0.011	0.026	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
14	F1Q6M9	8.3	33.5	2623	0.010	0.005	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
15	A0A8I5ZU83	8.8	33.5	26931	0.024	0.001	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
16	Q8WZ42	8.9	33.5	34350	0.013	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
17	Q568V0	9.2	33.1	420	0.011	0.036	Q568V0_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=foxg1 PE=2 SV=1
18	P07751	9.5	33.1	2477	0.015	0.008	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
19	Q42404	9.6	32.7	427	0.015	0.049	RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana OX=3702 GN=RNU1 PE=1 SV=1
20	F1QBY1	9.8	33.1	2876	0.009	0.004	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13424 TPR_12	6.9e+02	12.0	Tetratricopeptide repeat
2	PF14559 TPR_19	14	17.6	Tetratricopeptide repeat
3	PF07719 TPR_2	21	16.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357575

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000431759	0.768	Cilia- and flagella-associated protein 54
2	9606.ENSP00000355735	0.745	Endoplasmic reticulum membrane-associated RNA degradation protein
3	9606.ENSP00000386770	0.743	Dynein heavy chain 10, axonemal
4	9606.ENSP00000393222	0.707	Cilia- and flagella-associated protein 221
5	9606.ENSP00000368511	0.660	Putative uncharacterized protein CXorf58
6	9606.ENSP00000430853	0.635	Nuclear pore complex interacting protein family member B11
7	9606.ENSP00000417061	0.617	Cilia- and flagella-associated protein 74
8	9606.ENSP00000337946	0.612	Parkin coregulated gene protein
9	9606.ENSP00000361014	0.588	MAP kinase-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000417035	0.564	Putative uncharacterized protein C19orf81
11	9606.ENSP00000320219	0.549	Arylsulfatase family member J
12	9606.ENSP00000359942	0.548	Kelch-like protein 31
13	9606.ENSP00000310042	0.542	Zinc finger protein 622
14	9606.ENSP00000461382	0.539	Large neutral amino acids transporter small subunit 4
15	9606.ENSP00000321856	0.537	Cysteine rich with EGF like domains 1
16	9606.ENSP00000364567	0.524	[Protein ADP-ribosylarginine] hydrolase-like protein 1
17	9606.ENSP00000351767	0.513	Collagen alpha-1(XX) chain
18	9606.ENSP00000434727	0.512	Coiled-coil domain containing 180
19	9606.ENSP00000389813	0.511	Acyl-CoA dehydrogenase family member 10
20	9606.ENSP00000347444	0.509	Tudor domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0016043	0.792	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0043227	0.996	membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0043232	0.885	intracellular non-membrane-bounded organelle
GO:0005634	0.462	nucleus
GO:0005929	0.447	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]