StarFunc result for job id Q8IYW5

User Input

>input (571 residues)
MALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSS
WTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGQESEEVADDYQPVRLLSKPGELRREY
EEEISKVAAERRASEEEENKASEEYIQRLLAEEEEEEKRQAEKRRRAMEEQLKSDEELAR
KLSIDINNFCEGSISASPLNSRKSDPVTPKSEKKSKNKQRNTGDIQKYLTPKSQFGSASH
SEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPW
LCACGAEWYHEGNVKTRPSNHGKELCVLSHERPKTRVPYSKETAVMPCGRTESGCAPTSG
VTQTNGNNTGETENEESCLLISKEISKRKNQESSFEAVKDPCFSAKRRKVSPESSPDQEE
TEINFTQKLIDLEHLLFERHKQEEQDRLLALQLQKEVDKEQMVPNRQKGSPDEYHLRATS
SPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNST
RDHCKVSKSAHSLQPSISQKSVFQMFQRCTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYW5	1.000	1.000	4.343E-80	571	1.000	1.000	Q8IYW5.pdb.gz	RN168_HUMAN E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1
2	AFDB:Q80XJ2	0.390	0.394	1.158E-51	565	0.641	0.648	Q80XJ2.pdb.gz	RN168_MOUSE E3 ubiquitin-protein ligase RNF168 OS=Mus musculus OX=10090 GN=Rnf168 PE=1 SV=3
3	PDB:5dkaA	0.075	0.423	5.540E-3	96	0.025	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
4	PDB:4r8pL	0.118	0.248	6.740E-3	254	0.040	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
5	AFDB:Q9FUY2	0.133	0.093	1.482E-2	931	0.145	0.089	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
6	AFDB:Q8IEH2	0.064	0.021	1.689E-2	2518	0.081	0.018	Q8IEH2.pdb.gz	Q8IEH2_PLAF7 Telomerase reverse transcriptase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1314200 PE=3 SV=1
7	AFDB:Q6PBI4	0.133	0.130	2.849E-2	582	0.144	0.141	Q6PBI4.pdb.gz	HDA9B_DANRE Histone deacetylase 9-B OS=Danio rerio OX=7955 GN=hdac9b PE=2 SV=1
8	PDB:5gm6a	0.078	0.334	3.028E-2	123	0.026	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
9	PDB:7jzvA	0.104	0.218	3.932E-2	253	0.037	0.083	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
10	PDB:7oikA	0.072	0.014	4.783E-2	4426	0.033	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
11	AFDB:A6YP92	0.084	0.084	5.844E-2	566	0.116	0.117	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
12	AFDB:Q95XU6	0.132	0.106	7.109E-2	740	0.142	0.109	Q95XU6.pdb.gz	ZC3HE_CAEEL Zinc finger CCCH domain-containing protein 14 OS=Caenorhabditis elegans OX=6239 GN=sut-2 PE=3 SV=2
13	AFDB:Q7Z4V5	0.095	0.085	9.855E-2	671	0.091	0.077	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
14	PDB:2c2lA	0.107	0.211	1.194E-1	281	0.025	0.050	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
15	AFDB:Q69ZW3	0.067	0.037	1.199E-1	1231	0.117	0.054	Q69ZW3.pdb.gz	EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ehbp1 PE=1 SV=3
16	AFDB:Q9BJZ5	0.063	0.044	1.366E-1	967	0.084	0.050	Q9BJZ5.pdb.gz	FUSIL_DROME RNA-binding protein fusilli OS=Drosophila melanogaster OX=7227 GN=fus PE=2 SV=1
17	PDB:5l9uB	0.075	0.509	3.395E-1	71	0.025	0.197	5l9uB.pdb.gz
18	PDB:7z36B	0.116	0.144	4.129E-1	446	0.072	0.092	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
19	PDB:3m62A	0.114	0.070	5.023E-1	955	0.025	0.015	3m62A.pdb.gz
20	PDB:5a31B	0.076	0.448	7.936E-1	84	0.023	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80XJ2	0.0	645	565	0.643	0.650	RN168_MOUSE E3 ubiquitin-protein ligase RNF168 OS=Mus musculus OX=10090 GN=Rnf168 PE=1 SV=3
2	Q8IYW5	0.0	1177	571	1.000	1.000	RN168_HUMAN E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1
3	Q8NCN4	8.45e-16	83.2	708	0.114	0.092	RN169_HUMAN E3 ubiquitin-protein ligase RNF169 OS=Homo sapiens OX=9606 GN=RNF169 PE=1 SV=2
4	F4ICB5	5.69e-09	60.8	491	0.051	0.059	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
5	Q1L5Z9	1.44e-06	53.5	754	0.044	0.033	LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens OX=9606 GN=LONRF2 PE=1 SV=3
6	Q17RB8	1.48e-06	53.5	773	0.051	0.038	LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens OX=9606 GN=LONRF1 PE=1 SV=2
7	Q54DE4	4.66e-06	52.0	530	0.033	0.036	Q54DE4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292312 PE=4 SV=1
8	Q496Y0	1.24e-05	50.8	759	0.054	0.041	LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens OX=9606 GN=LONRF3 PE=1 SV=1
9	Q810I2	3.05e-05	49.3	483	0.039	0.046	TRI50_MOUSE E3 ubiquitin-protein ligase TRIM50 OS=Mus musculus OX=10090 GN=Trim50 PE=1 SV=1
10	P19474	4.02e-05	48.9	475	0.100	0.120	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	Q9FKA7	6.32e-05	48.1	617	0.042	0.039	ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana OX=3702 GN=ORTH1 PE=1 SV=1
12	Q5C8U4	8.14e-05	47.8	515	0.035	0.039	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
13	Q9UAC4	1.18e-04	47.4	475	0.032	0.038	Q9UAC4_DROME TRAF6 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
14	A0A0R4IUT0	1.33e-04	47.0	544	0.032	0.033	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
15	Q9W3I9	1.52e-04	47.0	475	0.032	0.038	Q9W3I9_DROME GH01161p OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=1 SV=1
16	Q5C8U3	1.63e-04	47.0	515	0.033	0.037	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
17	Q680I0	1.94e-04	46.6	623	0.044	0.040	ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana OX=3702 GN=ORTH5 PE=2 SV=1
18	O76064	2.12e-04	46.6	485	0.040	0.047	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
19	Q9C035	2.29e-04	46.2	493	0.082	0.095	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
20	Q86XT4	2.57e-04	46.2	487	0.051	0.060	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.003	28.7	Prokaryotic RING finger family 4
2	PF04564 U-box	7.4e+02	11.7	U-box domain
3	PF00097 zf-C3HC4	0.003	28.7	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.0094	27.1	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.025	25.7	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	1.5	20.3	zinc finger of C3HC4-type, RING
7	PF16685 zf-RING_10	3.6e+02	12.7	zinc RING finger of MSL2
8	PF13639 zf-RING_2	3	19.6	Ring finger domain
9	PF14634 zf-RING_5	0.19	23.0	zinc-RING finger domain
10	PF13445 zf-RING_UBOX	0.21	23.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320898

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316176	0.998	Ubiquitin-conjugating enzyme E2 N
2	9606.ENSP00000441543	0.997	Polyubiquitin-C
3	9606.ENSP00000371475	0.996	TP53-binding protein 1
4	9606.ENSP00000362578	0.993	E3 ubiquitin-protein ligase RNF8
5	9606.ENSP00000272317	0.989	Ubiquitin-40S ribosomal protein S27a
6	9606.ENSP00000304697	0.985	Polyubiquitin-B
7	9606.ENSP00000388107	0.981	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000418960	0.976	Breast cancer type 1 susceptibility protein
9	9606.ENSP00000434024	0.976	Histone H2AX
10	9606.ENSP00000426503	0.962	E3 ubiquitin-protein ligase RNF4
11	9606.ENSP00000366434	0.958	BRCA1-A complex subunit RAP80
12	9606.ENSP00000283131	0.957	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
13	9606.ENSP00000332194	0.953	Histone H2A type 2-C
14	9606.ENSP00000365588	0.951	Mediator of DNA damage checkpoint protein 1
15	9606.ENSP00000348056	0.941	SUMO-conjugating enzyme UBC9
16	9606.ENSP00000349722	0.937	Ubiquitin conjugating enzyme E2 D3
17	9606.ENSP00000262971	0.920	E3 SUMO-protein ligase PIAS4
18	9606.ENSP00000344504	0.907	Histone H1.0
19	9606.ENSP00000376077	0.907	Small ubiquitin-related modifier 1
20	9606.ENSP00000012443	0.900	Serine/threonine-protein phosphatase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0043130	1.000	ubiquitin binding
GO:0031491	1.000	nucleosome binding
GO:0070530	1.000	K63-linked polyubiquitin modification-dependent protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0097159	0.361	organic cyclic compound binding
GO:1901363	0.360	heterocyclic compound binding
GO:0003676	0.336	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.995	response to stimulus
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0019538	0.988	protein metabolic process
GO:0048523	0.987	negative regulation of cellular process
GO:0051052	0.987	regulation of DNA metabolic process
GO:0006281	0.986	DNA repair
GO:0048522	0.982	positive regulation of cellular process
GO:0009314	0.979	response to radiation
GO:0010468	0.979	regulation of gene expression
GO:0070647	0.970	protein modification by small protein conjugation or removal
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0051173	0.965	positive regulation of nitrogen compound metabolic process
GO:0032446	0.960	protein modification by small protein conjugation
GO:0051054	0.956	positive regulation of DNA metabolic process
GO:0031326	0.955	regulation of cellular biosynthetic process
GO:2001141	0.950	regulation of RNA biosynthetic process
GO:0045934	0.949	negative regulation of nucleobase-containing compound metabolic process
GO:2001020	0.936	regulation of response to DNA damage stimulus
GO:0006355	0.935	regulation of DNA-templated transcription
GO:0006282	0.914	regulation of DNA repair
GO:0048584	0.839	positive regulation of response to stimulus
GO:0016567	0.831	protein ubiquitination
GO:0006302	0.831	double-strand break repair
GO:0010605	0.789	negative regulation of macromolecule metabolic process
GO:0006508	0.711	proteolysis
GO:2001022	0.589	positive regulation of response to DNA damage stimulus
GO:0009056	0.577	catabolic process
GO:0010212	0.565	response to ionizing radiation
GO:0009057	0.555	macromolecule catabolic process
GO:0032784	0.541	regulation of DNA-templated transcription elongation
GO:0016570	0.430	histone modification
GO:0045739	0.411	positive regulation of DNA repair
GO:0044265	0.407	cellular macromolecule catabolic process
GO:0016574	0.319	histone ubiquitination
GO:0045892	0.307	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0005694	0.971	chromosome
GO:0140535	0.922	intracellular protein-containing complex
GO:0090734	0.701	site of DNA damage
GO:1990234	0.700	transferase complex
GO:0000151	0.657	ubiquitin ligase complex
GO:0035861	0.602	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]