StarFunc result for job id Q8IYX0

User Input

>input (411 residues)
MAKRPGSPGSREMGLLTFRDVVIEFSLEEWQCLDHAQQNLYRDVMLENYRNLVSLGIAVS
KPDLITCLEQNKEPWNIKRNEMVTKHPVMCSHFTQDLPPELGIKDSLQKVIPRRYGKSGH
DNLQVKTCKSMGECEVQKGGCNEVNQCLSTTQNKIFQTHKCVKVFGKFSNSNRHKTRHTG
KKHFKCKKYGKSFCMVSQLHQHQIIHTRENSYQCEECGKPFNCSSTLSKHKRIHTGEKPY
RCEECGKAFTWSSTLTKHRRIHTGEKPYTCEECGQAFSRSSTLANHKRIHTGEKPYTCEE
CGKAFSLSSSLTYHKRIHTGEKPYTCEECGKAFNCSSTLKKHKIIHTGEKPYKCKECGKA
FAFSSTLNTHKRIHTGEEPYKCEECDKAFKWSSSLANHKSMHTGEKPYKCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYX0	1.000	1.000	8.865E-71	411	1.000	1.000	Q8IYX0.pdb.gz	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
2	AFDB:Q96JC4	0.535	0.427	3.896E-55	524	0.791	0.620	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
3	AFDB:Q03923	0.548	0.395	6.903E-50	595	0.696	0.481	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
4	AFDB:A6NNF4	0.376	0.223	1.660E-47	738	0.674	0.375	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	AFDB:Q14593	0.464	0.342	1.981E-47	569	0.727	0.525	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
6	AFDB:Q8IYN0	0.529	0.414	2.229E-47	542	0.698	0.530	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
7	AFDB:Q05481	0.383	0.153	2.822E-47	1191	0.698	0.241	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	AFDB:Q03936	0.309	0.227	1.386E-46	586	0.740	0.519	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
9	AFDB:Q15928	0.397	0.348	1.386E-46	474	0.640	0.555	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	AFDB:Q9H8G1	0.527	0.395	1.554E-45	570	0.713	0.514	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
11	PDB:3w5kB	0.109	0.275	6.934E-5	110	0.097	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7o4iW	0.061	0.075	3.792E-1	312	0.061	0.080	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:5dkaA	0.072	0.237	8.656E-1	96	0.044	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6gejS	0.065	0.108	1.233	208	0.061	0.120	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:3mhhC	0.079	0.247	1.387	93	0.039	0.172	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
16	PDB:4kblA	0.079	0.082	1.656	395	0.066	0.068	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:7ad8D	0.051	0.067	1.976	280	0.049	0.071	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
18	PDB:7ena4	0.096	0.091	2.358	457	0.049	0.044	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:7pt6I	0.075	0.086	2.501	341	0.073	0.088	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
20	PDB:5c8dE	0.081	0.098	2.814	280	0.046	0.068	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	540	616	0.664	0.443	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	540	659	0.679	0.423	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	529	809	0.674	0.342	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	0.0	531	620	0.674	0.447	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	0.0	561	595	0.696	0.481	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	0.0	586	586	0.725	0.509	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q14593	0.0	559	569	0.701	0.506	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
8	Q15928	0.0	536	474	0.667	0.578	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
9	Q2NKJ9	0.0	577	569	0.708	0.511	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
10	Q5JVG8	0.0	518	444	0.640	0.592	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
11	Q8IYB9	0.0	533	648	0.655	0.415	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
12	Q8IYN0	0.0	554	542	0.691	0.524	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
13	Q8IYX0	0.0	850	411	1.000	1.000	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
14	Q8TD23	0.0	537	568	0.681	0.493	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
15	Q96H40	0.0	516	463	0.647	0.575	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
16	Q96JC4	0.0	662	524	0.791	0.620	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q9H8G1	0.0	573	570	0.708	0.511	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
18	Q05481	1.63e-174	521	1191	0.674	0.233	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
19	Q8IW36	8.47e-153	444	515	0.591	0.472	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
20	Q49A12	4.02e-151	440	536	0.552	0.424	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	27	16.1	Rad4 beta-hairpin domain 1
2	PF01722 BolA	11	17.8	BolA-like protein
3	PF07975 C1_4	8.1	18.1	TFIIH C1-like domain
4	PF14353 CpXC	74	14.8	CpXC protein
5	PF12552 DUF3741	0.7	21.1	Protein of unknown function (DUF3741)
6	PF01352 KRAB	1e-20	84.4	KRAB box
7	PF16919 PknG_rubred	5.5e+02	12.1	Protein kinase G rubredoxin domain
8	PF01286 XPA_N	3.3e-07	41.5	XPA protein N-terminal
9	PF00096 zf-C2H2	6.3e-29	109.9	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	1.8e-12	58.1	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	2.5e-15	66.9	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	21	16.5	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	2.5e-05	35.6	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	1.6e-61	213.4	Zinc-finger double domain
15	PF13909 zf-H2C2_5	79	14.4	C2H2-type zinc-finger domain
16	PF12874 zf-met	39	16.0	Zinc-finger of C2H2 type
17	PF02591 zf-RING_7	0.0065	27.9	C4-type zinc ribbon domain
18	PF13451 zf-trcl	3.3	19.0	Probable zinc-ribbon domain
19	PF18508 zf_C2H2_13	3.5e+02	12.2	Zinc finger domain
20	PF18439 zf_UBZ	3.7e-08	44.2	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032870

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000056389	0.514	Tyrosine-protein phosphatase non-receptor type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0031324	0.973	negative regulation of cellular metabolic process
GO:0051172	0.971	negative regulation of nitrogen compound metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0010605	0.934	negative regulation of macromolecule metabolic process
GO:0009987	0.790	cellular process
GO:0019219	0.671	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.630	regulation of RNA metabolic process
GO:0032502	0.622	developmental process
GO:0032501	0.581	multicellular organismal process
GO:0010468	0.505	regulation of gene expression
GO:2001141	0.498	regulation of RNA biosynthetic process
GO:0006355	0.486	regulation of DNA-templated transcription
GO:0048856	0.483	anatomical structure development
GO:0045934	0.467	negative regulation of nucleobase-containing compound metabolic process
GO:0007275	0.453	multicellular organism development
GO:1902679	0.439	negative regulation of RNA biosynthetic process
GO:0045892	0.432	negative regulation of DNA-templated transcription
GO:0050896	0.382	response to stimulus
GO:0048513	0.328	animal organ development
GO:0051716	0.323	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.951	nuclear lumen
GO:0005886	0.938	plasma membrane
GO:0005654	0.918	nucleoplasm
GO:0043228	0.917	non-membrane-bounded organelle
GO:0043232	0.909	intracellular non-membrane-bounded organelle
GO:0005737	0.563	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]