StarFunc result for job id Q8IYX4

User Input

>input (353 residues)
MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGSEV
FIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHN
HPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQEARLLPSPGPAPGQ
IALLKFSSHRAAAMAKKALVEGQSHLCGEQVAVEWLKPDLKQRLRQQLVGPFLRSPQPEG
SQLALARDKLGFQGARATLQLLCQRMKLGSPVFLTKCLGIGPAGWHRFWYQVVIPGHPVP
FSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSAGAEAGTMVKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RGE0	0.630	0.630	1.297E-62	353	0.918	0.918	F1RGE0.pdb.gz	F1RGE0_PIG DND microRNA-mediated repression inhibitor 1 OS=Sus scrofa OX=9823 GN=DND1 PE=4 SV=1
2	AFDB:D3ZQ06	0.613	0.615	1.704E-60	352	0.864	0.866	D3ZQ06.pdb.gz	D3ZQ06_RAT DND microRNA-mediated repression inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Dnd1 PE=4 SV=1
3	AFDB:Q7T1H5	0.540	0.467	3.264E-31	411	0.377	0.324	Q7T1H5.pdb.gz	DND1_DANRE Dead end protein 1 OS=Danio rerio OX=7955 GN=dnd PE=1 SV=1
4	AFDB:P86049	0.519	0.352	2.100E-27	533	0.337	0.223	P86049.pdb.gz	RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus OX=10090 GN=Rbm46 PE=1 SV=1
5	AFDB:Q5YD48	0.506	0.311	7.534E-27	595	0.360	0.213	Q5YD48.pdb.gz	A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus OX=10090 GN=A1cf PE=1 SV=2
6	AFDB:A2BIC5	0.508	0.312	2.366E-24	600	0.280	0.165	A2BIC5.pdb.gz
7	AFDB:A0AV96	0.516	0.317	3.552E-24	593	0.292	0.174	A0AV96.pdb.gz	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
8	AFDB:F8W9F8	0.491	0.297	3.921E-22	602	0.323	0.189	F8W9F8.pdb.gz	F8W9F8_HUMAN APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=2
9	AFDB:A0A0B4KH24	0.526	0.315	1.407E-21	611	0.246	0.142	A0A0B4KH24.pdb.gz	A0A0B4KH24_DROME Syncrip, isoform O OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
10	AFDB:O60506	0.507	0.300	5.049E-21	623	0.246	0.140	O60506.pdb.gz	HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2
11	PDB:6y53o	0.204	0.434	1.687E-8	160	0.093	0.206	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:7oqcF	0.214	0.281	1.894E-8	267	0.102	0.135	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:5lsbA	0.214	0.419	4.030E-8	176	0.082	0.165	5lsbA.pdb.gz
14	PDB:5vsuA	0.222	0.204	1.533E-7	387	0.116	0.106	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
15	PDB:7evoD	0.214	0.372	2.439E-7	200	0.085	0.150	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6r5kH	0.207	0.188	3.662E-7	394	0.110	0.099	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:6y5qq	0.207	0.397	5.828E-7	178	0.082	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.201	0.399	3.600E-5	171	0.085	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:5yzg1	0.217	0.311	8.601E-5	243	0.093	0.136	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:5gm6V	0.217	0.581	2.055E-4	128	0.048	0.133	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZQ06	0.0	591	352	0.864	0.866	D3ZQ06_RAT DND microRNA-mediated repression inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Dnd1 PE=4 SV=1
2	F1RGE0	0.0	634	353	0.918	0.918	F1RGE0_PIG DND microRNA-mediated repression inhibitor 1 OS=Sus scrofa OX=9823 GN=DND1 PE=4 SV=1
3	Q6VY05	0.0	593	352	0.864	0.866	DND1_MOUSE Dead end protein homolog 1 OS=Mus musculus OX=10090 GN=Dnd1 PE=1 SV=1
4	Q8IYX4	0.0	712	353	1.000	1.000	DND1_HUMAN Dead end protein homolog 1 OS=Homo sapiens OX=9606 GN=DND1 PE=1 SV=1
5	Q9NQ94	1.87e-53	187	594	0.249	0.148	A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=1
6	A0A8M1NHK4	4.27e-51	181	600	0.258	0.152	RBM47_DANRE RNA-binding protein 47 OS=Danio rerio OX=7955 GN=rbm47 PE=1 SV=1
7	Q7T1H5	3.81e-49	172	411	0.289	0.248	DND1_DANRE Dead end protein 1 OS=Danio rerio OX=7955 GN=dnd PE=1 SV=1
8	Q5YD48	6.39e-49	175	595	0.252	0.150	A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus OX=10090 GN=A1cf PE=1 SV=2
9	Q923K9	1.72e-48	174	594	0.249	0.148	A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus OX=10116 GN=A1cf PE=1 SV=1
10	F8W9F8	1.63e-47	171	602	0.232	0.136	F8W9F8_HUMAN APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=2
11	P86049	2.28e-44	161	533	0.272	0.180	RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus OX=10090 GN=Rbm46 PE=1 SV=1
12	Q8TBY0	6.56e-44	160	533	0.252	0.167	RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens OX=9606 GN=RBM46 PE=1 SV=1
13	Q91WT8	1.20e-42	158	590	0.263	0.158	RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus OX=10090 GN=Rbm47 PE=1 SV=1
14	B7ZLP7	4.50e-42	156	593	0.252	0.150	B7ZLP7_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=1
15	A0AV96	4.55e-42	156	593	0.252	0.150	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
16	Q9CT37	2.78e-38	142	381	0.210	0.194	Q9CT37_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=3
17	F7B5B5	6.61e-37	141	531	0.207	0.137	F7B5B5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
18	Q566E4	8.61e-37	142	632	0.210	0.117	Q566E4_RAT Heterogeneous nuclear ribonucleoprotein R OS=Rattus norvegicus OX=10116 GN=Hnrnpr PE=1 SV=1
19	Q8VHM5	8.96e-37	142	632	0.210	0.117	Q8VHM5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
20	Q99KG1	9.40e-37	142	601	0.210	0.123	Q99KG1_MOUSE Hnrpr protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14709 DND1_DSRM	4.4e-20	83.1	double strand RNA binding domain from DEAD END PROTEIN 1
2	PF00076 RRM_1	2.4e-11	54.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	2.7e+02	13.1	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445366

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341992	0.899	Nanos homolog 3
2	9606.ENSP00000250863	0.880	Deleted in azoospermia-like
3	9606.ENSP00000347444	0.824	Tudor domain-containing protein 7
4	9606.ENSP00000341021	0.761	Nanos homolog 2
5	9606.ENSP00000424838	0.755	Probable ATP-dependent RNA helicase DDX4
6	9606.ENSP00000393275	0.726	Nanos homolog 1
7	9606.ENSP00000245255	0.705	Piwi-like protein 1
8	9606.ENSP00000282369	0.672	E3 ubiquitin-protein ligase TRIM36
9	9606.ENSP00000246194	0.653	RNA-binding protein Raly
10	9606.ENSP00000300069	0.644	RNA-binding protein with multiple splicing 2
11	9606.ENSP00000276594	0.630	PR domain zinc finger protein 14
12	9606.ENSP00000371711	0.617	Doublesex- and mab-3-related transcription factor 1
13	9606.ENSP00000385269	0.600	ELAV-like protein 1
14	9606.ENSP00000376848	0.596	Proline-rich membrane anchor 1
15	9606.ENSP00000229304	0.587	C->U-editing enzyme APOBEC-1
16	9606.ENSP00000364119	0.576	Eukaryotic translation initiation factor 2 subunit 2
17	9606.ENSP00000454561	0.559	Uncharacterized protein C8orf88
18	9606.ENSP00000233557	0.546	Nuclear receptor-binding protein
19	9606.ENSP00000216297	0.535	FACT complex subunit SPT16
20	9606.ENSP00000387303	0.535	ATP-dependent RNA helicase TDRD9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048519	0.968	negative regulation of biological process
GO:0043487	0.945	regulation of RNA stability
GO:0061013	0.941	regulation of mRNA catabolic process
GO:0048518	0.938	positive regulation of biological process
GO:0043488	0.915	regulation of mRNA stability
GO:0048522	0.857	positive regulation of cellular process
GO:0009893	0.832	positive regulation of metabolic process
GO:0034248	0.830	regulation of amide metabolic process
GO:0060966	0.830	regulation of gene silencing by RNA
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0051172	0.798	negative regulation of nitrogen compound metabolic process
GO:0031325	0.792	positive regulation of cellular metabolic process
GO:0060147	0.779	regulation of post-transcriptional gene silencing
GO:0051173	0.751	positive regulation of nitrogen compound metabolic process
GO:2000112	0.739	regulation of cellular macromolecule biosynthetic process
GO:0048523	0.734	negative regulation of cellular process
GO:0010605	0.723	negative regulation of macromolecule metabolic process
GO:0051246	0.717	regulation of protein metabolic process
GO:0006417	0.680	regulation of translation
GO:0031324	0.675	negative regulation of cellular metabolic process
GO:0032502	0.594	developmental process
GO:0032501	0.573	multicellular organismal process
GO:0010629	0.562	negative regulation of gene expression
GO:0048856	0.545	anatomical structure development
GO:0031331	0.538	positive regulation of cellular catabolic process
GO:0045935	0.506	positive regulation of nucleobase-containing compound metabolic process
GO:0050779	0.489	RNA destabilization
GO:0010628	0.434	positive regulation of gene expression
GO:0017148	0.426	negative regulation of translation
GO:0008152	0.422	metabolic process
GO:0071704	0.412	organic substance metabolic process
GO:0044237	0.403	cellular metabolic process
GO:0044238	0.394	primary metabolic process
GO:0006807	0.386	nitrogen compound metabolic process
GO:0043170	0.301	macromolecule metabolic process
GO:1903313	0.300	positive regulation of mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.955	intracellular organelle lumen
GO:0031981	0.859	nuclear lumen
GO:0005654	0.702	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]