StarFunc result for job id Q8IZ07

User Input

>input (590 residues)
MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVL
LRHKADVTKENRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAP
DFYVQMKWEFTSWVPLVSRICPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKG
EDNWAELMEVNHDDKVVTTERFDLSQEMERLTLDLMKPKSREVERRLTSPVINTSLDTKN
IAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKIRTEHLTEEEKKRYKADRNPL
ESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRPKELTIRTQKF
KAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHL
QDEDYEIMQFAIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLC
PSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3ZTS7	0.833	0.833	1.258E-98	590	1.000	1.000	Q3ZTS7.pdb.gz	Q3ZTS7_HUMAN Ankyrin repeat domain 13, isoform CRA_b OS=Homo sapiens OX=9606 GN=ANKRD13 PE=2 SV=1
2	AFDB:A0A024QZ29	0.750	0.709	2.219E-62	626	0.527	0.497	A0A024QZ29.pdb.gz
3	AFDB:Q6ZTN6	0.633	0.717	3.501E-53	518	0.449	0.512	Q6ZTN6.pdb.gz	AN13D_HUMAN Ankyrin repeat domain-containing protein 13D OS=Homo sapiens OX=9606 GN=ANKRD13D PE=1 SV=3
4	AFDB:Q7K4M9	0.723	0.674	2.252E-52	637	0.410	0.380	Q7K4M9.pdb.gz	Q7K4M9_DROME LD31969p OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
5	AFDB:Q8N6S4	0.623	0.677	1.054E-35	541	0.263	0.287	Q8N6S4.pdb.gz	AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens OX=9606 GN=ANKRD13C PE=1 SV=2
6	AFDB:Q94CF4	0.515	0.489	2.516E-25	624	0.210	0.199	Q94CF4.pdb.gz	Q94CF4_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g62050 PE=1 SV=1
7	AFDB:Q8WWX0	0.145	0.257	1.115E-4	329	0.053	0.094	Q8WWX0.pdb.gz	ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens OX=9606 GN=ASB5 PE=2 SV=1
8	AFDB:Q503N0	0.152	0.276	2.039E-4	314	0.061	0.115	Q503N0.pdb.gz
9	PDB:2w7qA	0.152	0.387	2.105E-4	192	0.058	0.177	2w7qA.pdb.gz
10	PDB:1wg0A	0.139	0.329	4.257E-4	243	0.042	0.103	1wg0A.pdb.gz
11	PDB:6jd6B	0.103	0.241	4.257E-4	192	0.044	0.135	6jd6B.pdb.gz
12	AFDB:Q8GZ22	0.136	0.324	4.796E-4	240	0.049	0.121	Q8GZ22.pdb.gz	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
13	PDB:2dvwA	0.143	0.360	5.206E-4	229	0.042	0.109	2dvwA.pdb.gz
14	PDB:8cs9A	0.138	0.103	5.475E-4	796	0.039	0.029	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	AFDB:P42570	0.145	0.468	6.168E-4	174	0.049	0.167	P42570.pdb.gz	PLU_DROME DNA replication inhibitor plutonium OS=Drosophila melanogaster OX=7227 GN=plu PE=1 SV=1
16	PDB:6v9hC	0.147	0.310	1.107E-3	270	0.046	0.100	6v9hC.pdb.gz
17	PDB:4oauC	0.139	0.119	1.424E-3	692	0.041	0.035	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
18	PDB:3mh9A	0.168	0.409	1.575E-3	205	0.047	0.137	3mh9A.pdb.gz
19	PDB:2byoA	0.154	0.410	1.656E-3	183	0.049	0.158	2byoA.pdb.gz	Lppx is a Lipoprotein Required for the Translocation of Phthiocerol Dimycocerosates to the Surface of Mycobacterium Tuberculosis.
20	PDB:7df7B	0.137	0.640	3.184E-3	119	0.037	0.185	7df7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ZTS7	0.0	1228	590	1.000	1.000	Q3ZTS7_HUMAN Ankyrin repeat domain 13, isoform CRA_b OS=Homo sapiens OX=9606 GN=ANKRD13 PE=2 SV=1
2	Q6ZTN6	0.0	613	605	0.541	0.527	AN13D_HUMAN Ankyrin repeat domain-containing protein 13D OS=Homo sapiens OX=9606 GN=ANKRD13D PE=1 SV=3
3	Q86YJ7	0.0	574	626	0.507	0.478	AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens OX=9606 GN=ANKRD13B PE=1 SV=4
4	Q8IZ07	0.0	1228	590	1.000	1.000	AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens OX=9606 GN=ANKRD13A PE=1 SV=3
5	Q7K4M9	1.00e-146	439	637	0.424	0.392	Q7K4M9_DROME LD31969p OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
6	Q8IGB6	2.76e-140	422	618	0.412	0.393	Q8IGB6_DROME RH65876p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG15118 PE=2 SV=1
7	A8DYI9	5.93e-139	419	630	0.375	0.351	A8DYI9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
8	A1ZBH1	3.45e-134	405	592	0.398	0.397	A1ZBH1_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
9	S4R3U2	2.51e-117	347	173	0.278	0.948	S4R3U2_HUMAN Ankyrin repeat domain 13A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD13A PE=1 SV=1
10	Q8N6S4	9.76e-76	252	541	0.259	0.283	AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens OX=9606 GN=ANKRD13C PE=1 SV=2
11	Q94CF4	1.82e-18	91.7	624	0.088	0.083	Q94CF4_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g62050 PE=1 SV=1
12	Q7T3Y0	8.80e-08	52.8	112	0.049	0.259	NARPA_DANRE Notch-regulated ankyrin repeat-containing protein A OS=Danio rerio OX=7955 GN=nrarpa PE=2 SV=1
13	Q9EP71	1.19e-07	57.4	979	0.041	0.025	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
14	Q7Z6K4	1.46e-07	52.4	114	0.049	0.254	NRARP_HUMAN Notch-regulated ankyrin repeat-containing protein OS=Homo sapiens OX=9606 GN=NRARP PE=1 SV=1
15	Q91ZA8	1.46e-07	52.4	114	0.049	0.254	NRARP_MOUSE Notch-regulated ankyrin repeat-containing protein OS=Mus musculus OX=10090 GN=Nrarp PE=1 SV=1
16	Q9VBP3	1.67e-07	57.0	1181	0.056	0.028	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
17	Q7T3X9	3.31e-07	51.2	111	0.047	0.252	NARPB_DANRE Notch-regulated ankyrin repeat-containing protein B OS=Danio rerio OX=7955 GN=nrarpb PE=2 SV=1
18	Q8N8A2	1.25e-06	53.9	993	0.042	0.025	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
19	Q9H2K2	1.27e-06	53.9	1166	0.058	0.029	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1
20	O70511	1.36e-06	54.3	2622	0.051	0.011	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0013	30.2	Ankyrin repeat
2	PF12796 Ank_2	1e-06	40.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.8e-05	33.5	Ankyrin repeat
4	PF13637 Ank_4	3.3e-07	42.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.0009	30.8	Ankyrin repeats (many copies)
6	PF11904 GPCR_chapero_1	5.9e-95	329.8	GPCR-chaperone
7	PF11545 HemeBinding_Shp	95	14.3	Cell surface heme-binding protein Shp

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261739

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420040	0.667	Kv channel-interacting protein 2
2	9606.ENSP00000351777	0.625	Transitional endoplasmic reticulum ATPase
3	9606.ENSP00000281243	0.615	Dihydropteridine reductase
4	9606.ENSP00000301281	0.609	UBX domain-containing protein 6
5	9606.ENSP00000219302	0.587	Nucleoside diphosphate kinase 3
6	9606.ENSP00000362702	0.551	Serine/threonine-protein kinase Nek6
7	9606.ENSP00000386911	0.543	Rho GTPase-activating protein 25
8	9606.ENSP00000338413	0.531	Ubiquitin-like modifier-activating enzyme 1
9	9606.ENSP00000289528	0.525	Zinc finger AN1-type containing 2B
10	9606.ENSP00000343515	0.523	Transcription elongation factor A protein 2
11	9606.ENSP00000296786	0.505	Ubiquitin-like domain-containing CTD phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140035	1.000	ubiquitination-like modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0002090	0.991	regulation of receptor internalization
GO:0048523	0.899	negative regulation of cellular process
GO:0032880	0.836	regulation of protein localization
GO:0009987	0.806	cellular process
GO:1903828	0.681	negative regulation of protein localization
GO:0045806	0.672	negative regulation of endocytosis
GO:0048261	0.630	negative regulation of receptor-mediated endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031982	0.897	vesicle
GO:0031410	0.791	cytoplasmic vesicle
GO:0048471	0.432	perinuclear region of cytoplasm
GO:0005768	0.399	endosome
GO:0005829	0.395	cytosol
GO:0005634	0.393	nucleus
GO:0005770	0.343	late endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]