StarFunc result for job id Q8IZ20

User Input

>input (524 residues)
MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASW
LCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDD
KKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNS
ISKELPFLLHAFYPGYPLLLPPPHLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMV
NELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPL
SSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFT
QLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLH
SGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMA
VASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZ20	0.999	0.999	9.651E-81	524	1.000	1.000	Q8IZ20.pdb.gz	ZN683_HUMAN Tissue-resident T-cell transcription regulator protein ZNF683 OS=Homo sapiens OX=9606 GN=ZNF683 PE=1 SV=3
2	AFDB:O75626	0.231	0.151	1.464E-22	825	0.344	0.218	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
3	AFDB:A0A096MJU6	0.234	0.147	1.173E-21	857	0.340	0.208	A0A096MJU6.pdb.gz	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
4	AFDB:Q5MB23	0.244	0.169	1.173E-21	776	0.294	0.198	Q5MB23.pdb.gz
5	AFDB:A0A2R8Q3C5	0.212	0.167	1.891E-12	672	0.204	0.159	A0A2R8Q3C5.pdb.gz
6	AFDB:Q923B3	0.211	0.136	2.453E-12	828	0.189	0.120	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
7	AFDB:Q921B4	0.210	0.136	6.336E-11	824	0.176	0.112	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
8	AFDB:P41183	0.204	0.152	8.770E-11	707	0.216	0.160	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
9	AFDB:Q5BIH1	0.165	0.110	5.782E-10	803	0.193	0.126	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
10	AFDB:F1R5N6	0.195	0.147	1.038E-9	718	0.191	0.139	F1R5N6.pdb.gz	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
11	PDB:3w5kB	0.083	0.252	3.314E-4	110	0.069	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7dvqM	0.042	0.082	1.200	191	0.032	0.089	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:7o4iW	0.049	0.074	1.772	312	0.052	0.087	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:3cpeA	0.050	0.048	1.891	553	0.010	0.009	3cpeA.pdb.gz
15	PDB:7ad8D	0.042	0.071	2.982	280	0.036	0.068	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
16	PDB:1yw5A	0.041	0.103	3.182	177	0.011	0.034	1yw5A.pdb.gz
17	PDB:6fyxm	0.041	0.136	3.182	147	0.013	0.048	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
18	PDB:4v6wCr	0.060	0.143	3.396	134	0.034	0.134	4v6wCr.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:6rw4O	0.053	0.092	3.396	194	0.053	0.144	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
20	PDB:5in4A	0.036	0.052	3.624	355	0.010	0.014	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZ20	0.0	1065	524	1.000	1.000	ZN683_HUMAN Tissue-resident T-cell transcription regulator protein ZNF683 OS=Homo sapiens OX=9606 GN=ZNF683 PE=1 SV=3
2	I7HJS4	9.26e-164	474	458	0.523	0.598	ZN683_MOUSE Tissue-resident T-cell transcription regulator protein ZNF683 OS=Mus musculus OX=10090 GN=Znf683 PE=2 SV=1
3	O75626	1.95e-60	215	825	0.223	0.142	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
4	D4A1S2	2.34e-60	215	824	0.223	0.142	D4A1S2_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
5	Q60636	3.29e-60	215	856	0.223	0.137	PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1
6	A0A096MJU6	4.62e-60	214	857	0.223	0.137	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
7	Q68EH4	1.34e-56	204	776	0.181	0.122	Q68EH4_DANRE PR domain zinc finger protein 1 OS=Danio rerio OX=7955 GN=Blimp-1 PE=2 SV=2
8	Q9VRN4	8.28e-54	198	1203	0.185	0.081	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
9	M9PBR0	8.36e-54	198	1216	0.185	0.080	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
10	Q93560	2.47e-49	184	817	0.160	0.103	BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=blmp-1 PE=1 SV=1
11	P13360	1.30e-26	115	604	0.109	0.094	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
12	A6NJL1	4.73e-26	113	495	0.099	0.105	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
13	Q3SY52	5.29e-26	113	487	0.149	0.160	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
14	A0A1Y7VLS7	5.48e-26	110	312	0.099	0.167	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
15	Q3UT31	6.03e-26	110	312	0.099	0.167	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
16	P41183	1.74e-25	112	707	0.099	0.074	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
17	P41182	1.99e-25	112	706	0.099	0.074	BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens OX=9606 GN=BCL6 PE=1 SV=1
18	Q9JIC0	4.65e-25	110	545	0.109	0.105	Q9JIC0_MOUSE KRAB zinc finger protein OS=Mus musculus OX=10090 GN=Zfp119a PE=2 SV=1
19	G3V9G6	6.09e-25	111	740	0.103	0.073	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
20	Q62788	6.76e-25	111	744	0.103	0.073	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	5.1e+02	12.0	Baculovirus immediate-early protein (IE-0)
2	PF03107 C1_2	1.8e+02	13.9	C1 domain
3	PF02892 zf-BED	1.2e+02	14.1	BED zinc finger
4	PF00096 zf-C2H2	1.5e-12	58.4	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	4.5e-05	34.9	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	5.5	18.4	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	5	18.8	Zinc-finger double-stranded RNA-binding
8	PF16278 zf-C2HE	8.4e+02	11.9	C2HE / C2H2 / C2HC zinc-binding finger
9	PF13465 zf-H2C2_2	1.4e-12	58.6	Zinc-finger double domain
10	PF12874 zf-met	0.019	26.6	Zinc-finger of C2H2 type
11	PF09723 Zn-ribbon_8	2.5e+02	13.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000007546

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000001296	0.580	Establishment of sister chromatid cohesion N-acetyltransferase 1
2	9593.ENSGGOP00000007901	0.527	Ankyrin repeat and EF-hand domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000987	0.997	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.329	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0019222	0.914	regulation of metabolic process
GO:0060255	0.904	regulation of macromolecule metabolic process
GO:0048523	0.900	negative regulation of cellular process
GO:0050896	0.892	response to stimulus
GO:0031323	0.886	regulation of cellular metabolic process
GO:0010468	0.885	regulation of gene expression
GO:0080090	0.879	regulation of primary metabolic process
GO:0051171	0.879	regulation of nitrogen compound metabolic process
GO:0019219	0.847	regulation of nucleobase-containing compound metabolic process
GO:0002376	0.781	immune system process
GO:0010556	0.739	regulation of macromolecule biosynthetic process
GO:0031326	0.739	regulation of cellular biosynthetic process
GO:0048518	0.736	positive regulation of biological process
GO:0006355	0.714	regulation of DNA-templated transcription
GO:0051716	0.693	cellular response to stimulus
GO:0007165	0.637	signal transduction
GO:0009892	0.357	negative regulation of metabolic process
GO:0002682	0.324	regulation of immune system process
GO:0048522	0.311	positive regulation of cellular process
GO:0048583	0.306	regulation of response to stimulus
GO:0042221	0.301	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.604	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]