StarFunc result for job id Q8IZ73

User Input

>input (545 residues)
MWLDRRGWLRVLGHWRYDLRRPSFTRTWSGDKGPMAETVSTQVGTEGGLRASHQQNGDAG
GDAKVELSPGPPKPAGREVEPAPVGGEHPSAAAPGPGKHKKRRGATRERVVPPPKKRRTG
VSFGDEHFAETSYYFEGGLRKVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPLAYYEA
AVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSS
IPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDR
QLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGQSSVV
RCRPLTGRTHQIRVHLQFLGHPILNDPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQ
AKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEEVAEAAPQELDTIAL
ASEKAVETDVMNQETDPLCAECRLVRQDPLPQDLVMFLHALRYKGPGFEYFSPMPAWAQD
DWQKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZ73	1.000	1.000	6.225E-101	545	1.000	1.000	Q8IZ73.pdb.gz	RUSD2_HUMAN Pseudouridylate synthase RPUSD2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2
2	AFDB:Q9VKU8	0.629	0.627	1.105E-50	547	0.402	0.400	Q9VKU8.pdb.gz	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
3	AFDB:Q09709	0.590	0.806	5.890E-42	394	0.286	0.396	Q09709.pdb.gz	YA32_SCHPO Pseudouridylate synthase C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1
4	AFDB:P0AA39	0.312	0.524	1.542E-20	319	0.169	0.288	P0AA39.pdb.gz	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
5	PDB:2istA	0.314	0.491	7.793E-19	321	0.136	0.231	2istA.pdb.gz
6	AFDB:O07166	0.357	0.599	3.133E-17	305	0.134	0.239	O07166.pdb.gz	O07166_MYCTU Pseudouridine synthase RsuA/RluA-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3300c PE=4 SV=1
7	PDB:2i82A	0.294	0.709	1.373E-14	217	0.106	0.267	2i82A.pdb.gz	Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure
8	PDB:6yxxEC	0.271	0.386	2.087E-12	373	0.101	0.147	6yxxEC.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
9	PDB:3dh3B	0.186	0.398	7.573E-7	241	0.075	0.170	3dh3B.pdb.gz	Crystal structure of an RluF-RNA complex: a base-pair rearrangement is the key to selectivity of RluF for U2604 of the ribosome.
10	PDB:1kskA	0.199	0.428	9.921E-7	234	0.064	0.150	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
11	PDB:2olwA	0.203	0.560	7.727E-6	179	0.059	0.179	2olwA.pdb.gz
12	PDB:2rfkA	0.202	0.316	8.962E-4	334	0.062	0.102	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
13	PDB:2apoA	0.165	0.281	4.782E-3	304	0.057	0.102	2apoA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
14	PDB:7v9aC	0.174	0.230	7.776E-3	393	0.050	0.069	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
15	PDB:1k8wA	0.181	0.299	9.651E-3	304	0.062	0.112	1k8wA.pdb.gz	Cocrystal structure of a tRNA Psi55 pseudouridine synthase: nucleotide flipping by an RNA-modifying enzyme.
16	AFDB:O35431	0.057	0.049	5.662E-1	750	0.079	0.057	O35431.pdb.gz	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
17	AFDB:O80871	0.058	0.069	1.206	396	0.064	0.088	O80871.pdb.gz	P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana OX=3702 GN=At2g30020 PE=1 SV=1
18	AFDB:Q586F1	0.064	0.024	1.580	1992	0.057	0.016	Q586F1.pdb.gz	Q586F1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.305 PE=4 SV=1
19	AFDB:O00841	0.060	0.046	2.185	802	0.042	0.029	O00841.pdb.gz	CUDA_DICDI Putative transcriptional regulator cudA OS=Dictyostelium discoideum OX=44689 GN=cudA PE=1 SV=2
20	AFDB:O95819	0.086	0.049	2.306	1239	0.105	0.046	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZ73	0.0	1125	545	1.000	1.000	RUSD2_HUMAN Pseudouridylate synthase RPUSD2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2
2	Q9VKU8	1.36e-139	416	547	0.391	0.389	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
3	M9MRH0	5.27e-139	415	543	0.391	0.392	M9MRH0_DROME RluA pseudouridine synthase 2, isoform C OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=1
4	Q09709	6.37e-95	296	394	0.299	0.414	YA32_SCHPO Pseudouridylate synthase C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1
5	Q12362	1.78e-86	280	591	0.251	0.232	RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1
6	Q12069	3.28e-84	271	462	0.233	0.275	PUS9_YEAST tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS9 PE=1 SV=1
7	F4KBV6	9.06e-70	231	410	0.209	0.278	F4KBV6_ARATH Pseudouridine synthase OS=Arabidopsis thaliana OX=3702 GN=MWD22.8 PE=1 SV=1
8	P53294	2.70e-55	193	404	0.262	0.354	PUS6_YEAST tRNA pseudouridine(31) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS6 PE=1 SV=1
9	P0AA39	4.14e-28	116	319	0.138	0.235	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
10	M9PFI9	1.11e-22	98.6	219	0.097	0.242	M9PFI9_DROME RluA pseudouridine synthase 2, isoform E OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=4 SV=1
11	P0AA37	1.41e-19	89.7	219	0.106	0.265	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
12	P33643	1.91e-19	91.7	326	0.106	0.178	RLUD_ECOLI Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=rluD PE=1 SV=4
13	O07166	2.46e-19	90.9	305	0.110	0.197	O07166_MYCTU Pseudouridine synthase RsuA/RluA-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3300c PE=4 SV=1
14	O25114	2.60e-17	84.7	298	0.101	0.185	Y347_HELPY Uncharacterized RNA pseudouridine synthase HP_0347 OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0347 PE=1 SV=1
15	Q96CM3	9.68e-13	72.0	377	0.117	0.170	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
16	Q9CWX4	1.72e-12	71.2	377	0.132	0.191	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
17	P0AA41	6.98e-12	68.2	260	0.095	0.200	TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=truC PE=1 SV=1
18	Q9UJJ7	2.07e-08	58.2	312	0.079	0.138	RUSD1_HUMAN RNA pseudouridylate synthase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RPUSD1 PE=1 SV=1
19	Q3ECD0	2.21e-08	58.9	430	0.117	0.149	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
20	Q7XA65	5.35e-08	57.0	322	0.106	0.180	PUS1_ARATH RNA pseudouridine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=At1g56345 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00849 PseudoU_synth_2	1e-28	112.0	RNA pseudouridylate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348722	0.888	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
2	9606.ENSP00000365837	0.848	tRNA pseudouridine synthase A
3	9606.ENSP00000298746	0.827	Probable tRNA pseudouridine synthase 1
4	9606.ENSP00000415899	0.823	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
5	9606.ENSP00000220496	0.803	DnaJ homolog subfamily C member 17
6	9606.ENSP00000227474	0.779	tRNA pseudouridine(38/39) synthase
7	9606.ENSP00000260447	0.768	GTP cyclohydrolase 1 feedback regulatory protein
8	9606.ENSP00000326003	0.762	Putative tRNA pseudouridine synthase Pus10
9	9606.ENSP00000373331	0.745	Mitochondrial mRNA pseudouridine synthase RPUSD3
10	9606.ENSP00000361982	0.726	Mitochondrial mRNA pseudouridine synthase TRUB2
11	9606.ENSP00000260385	0.725	Regulator of microtubule dynamics protein 3
12	9606.ENSP00000358563	0.712	H/ACA ribonucleoprotein complex subunit 4
13	9606.ENSP00000234195	0.689	Regulator of microtubule dynamics 2
14	9606.ENSP00000264414	0.689	Cullin-3
15	9606.ENSP00000246868	0.679	Ribosome maturation protein SBDS
16	9606.ENSP00000226796	0.662	H/ACA ribonucleoprotein complex subunit 1
17	9606.ENSP00000274606	0.650	H/ACA ribonucleoprotein complex subunit 2
18	9606.ENSP00000351644	0.641	tRNA modification GTPase GTPBP3, mitochondrial
19	9606.ENSP00000332198	0.633	H/ACA ribonucleoprotein complex subunit 3
20	9606.ENSP00000256854	0.629	Asparagine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009982	1.000	pseudouridine synthase activity
GO:0003723	1.000	RNA binding
GO:0005515	0.859	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016070	0.995	RNA metabolic process
GO:0009451	0.952	RNA modification
GO:0016556	0.936	mRNA modification
GO:0001522	0.911	pseudouridine synthesis
GO:0010467	0.505	gene expression
GO:0065007	0.455	biological regulation
GO:0050789	0.419	regulation of biological process
GO:0034660	0.383	ncRNA metabolic process
GO:0006396	0.370	RNA processing
GO:0034470	0.357	ncRNA processing
GO:0050794	0.301	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005739	0.995	mitochondrion
GO:0005829	0.989	cytosol
GO:0070013	0.956	intracellular organelle lumen
GO:0031981	0.714	nuclear lumen
GO:0005654	0.496	nucleoplasm
GO:0043232	0.375	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	1.000	Intramolecular transferases.

[back to server]