StarFunc result for job id Q8IZA0

User Input

>input (1049 residues)
MEKRLGVKPNPASWILSGYYWQTSAKWLRSLYLFYTCFCFSVLWLSTDASESRCQQGKTQ
FGVGLRSGGENHLWLLEGTPSLQSCWAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFR
THSSNSMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQ
SLIRKLQKRGSPSDVVTPIVTQHSKVNDSNELGGLTTSGSAEVHKAITISSPLTTDLTAE
LSGGPKNVSVQPEISEGLATTPSTQQVKSSEKTQIAVPQPVAPSYSYATPTPQASFQSTS
APYPVIKELVVSAGESVQITLPKNEVQLNAYVLQEPPKGETYTYDWQLITHPRDYSGEME
GKHSQILKLSKLTPGLYEFKVIVEGQNAHGEGYVNVTVKPEPRKNRPPIAIVSPQFQEIS
LPTTSTVIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVV
DSDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSL
SPSSKGKVVEMQGVRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENNKPPQ
ADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLWEKTQGPDGVQLENANSSVATVTGLQV
GTYVFTLTVKDERNLQSQSSVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDD
KGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTV
EVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGVLDSDIIVQKIQPYTEQSTK
MVFFVQNEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSF
TKRCICDPFWMENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGILSWTVICCCKRQKG
KPKRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDRE
KGKLLHGQNGSVPNGQTPLKARSPREEIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VV43	0.435	0.426	0.000	1072	0.484	0.474	Q5VV43.pdb.gz	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
2	AFDB:Q8IZA0	0.999	0.999	0.000	1049	1.000	1.000	Q8IZA0.pdb.gz	K319L_HUMAN Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2
3	AFDB:Q8K135	0.489	0.490	0.000	1048	0.843	0.844	Q8K135.pdb.gz	K319L_MOUSE Dyslexia-associated protein KIAA0319-like protein OS=Mus musculus OX=10090 GN=Kiaa0319l PE=1 SV=1
4	AFDB:Q6WRH9	0.113	0.059	1.060E-18	2597	0.124	0.050	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
5	AFDB:Q8STB9	0.115	0.120	1.060E-18	997	0.118	0.124	Q8STB9.pdb.gz	Q8STB9_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
6	PDB:4aq1A	0.117	0.160	1.497E-15	721	0.077	0.112	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
7	AFDB:F7BJK1	0.130	0.128	1.844E-15	1077	0.109	0.106	F7BJK1.pdb.gz	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
8	PDB:7sqcO0	0.109	0.102	7.770E-15	1140	0.064	0.059	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	AFDB:Q9P2J2	0.098	0.090	1.967E-14	1179	0.107	0.095	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
10	AFDB:B7YZW3	0.110	0.072	3.464E-14	2064	0.124	0.063	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
11	PDB:1e07A	0.095	0.141	2.707E-13	642	0.051	0.084	1e07A.pdb.gz
12	AFDB:O88689	0.143	0.154	3.695E-13	947	0.101	0.112	O88689.pdb.gz	PCDA4_MOUSE Protocadherin alpha-4 OS=Mus musculus OX=10090 GN=Pcdha4 PE=1 SV=1
13	PDB:5oj2B	0.087	0.120	4.357E-12	692	0.069	0.104	5oj2B.pdb.gz
14	AFDB:Q17R88	0.096	0.085	2.153E-11	1222	0.117	0.101	Q17R88.pdb.gz	Q17R88_HUMAN Sortilin-related VPS10 domain containing receptor 3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=2 SV=1
15	PDB:7q1yA	0.084	0.069	4.414E-11	1374	0.066	0.050	7q1yA.pdb.gz
16	PDB:5a42A	0.082	0.060	1.682E-10	1597	0.076	0.050	5a42A.pdb.gz
17	PDB:7q5zA	0.089	0.075	1.771E-10	1344	0.073	0.057	7q5zA.pdb.gz
18	PDB:4ziqA	0.079	0.063	1.865E-10	1450	0.071	0.052	4ziqA.pdb.gz
19	PDB:4rtdA	0.075	0.071	2.412E-10	1122	0.065	0.061	4rtdA.pdb.gz
20	PDB:2rcjC	0.091	0.146	1.268E-8	523	0.067	0.134	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EN73	0.0	2117	1026	0.978	1.000	E7EN73_HUMAN Dyslexia-associated protein KIAA0319-like protein (Fragment) OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=1
2	Q5SZV5	0.0	786	1081	0.391	0.379	K0319_MOUSE Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1
3	Q5VV43	0.0	899	1072	0.486	0.476	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
4	Q8IZA0	0.0	2163	1049	1.000	1.000	K319L_HUMAN Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2
5	Q8K135	0.0	1807	1048	0.844	0.844	K319L_MOUSE Dyslexia-associated protein KIAA0319-like protein OS=Mus musculus OX=10090 GN=Kiaa0319l PE=1 SV=1
6	A0A087X0U9	6.06e-179	532	483	0.256	0.557	A0A087X0U9_HUMAN KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
7	Q86VZ4	2.30e-17	89.0	500	0.051	0.106	LRP11_HUMAN Low-density lipoprotein receptor-related protein 11 OS=Homo sapiens OX=9606 GN=LRP11 PE=2 SV=2
8	Q8CB67	9.64e-16	83.6	483	0.042	0.091	LRP11_MOUSE Low-density lipoprotein receptor-related protein 11 OS=Mus musculus OX=10090 GN=Lrp11 PE=1 SV=1
9	A0A2R8QCE4	6.04e-11	68.6	523	0.038	0.076	A0A2R8QCE4_DANRE Serine peptidase inhibitor, Kunitz type 1 a OS=Danio rerio OX=7955 GN=cb376 PE=1 SV=1
10	A9JR82	8.58e-11	68.2	499	0.036	0.076	A9JR82_DANRE Serine peptidase inhibitor, Kunitz type 1 b precursor OS=Danio rerio OX=7955 GN=spint1b PE=1 SV=1
11	Q7T363	1.13e-09	64.7	516	0.038	0.078	Q7T363_DANRE Serine peptidase inhibitor, Kunitz type 1 a precursor OS=Danio rerio OX=7955 GN=zgc:64075 PE=1 SV=1
12	Q9X721	7.22e-05	49.3	1118	0.035	0.033	COLG_HATHI Collagenase ColG OS=Hathewaya histolytica OX=1498 GN=colG PE=1 SV=1
13	Q46085	0.040	40.4	1021	0.038	0.039	COLH_HATHI Collagenase ColH OS=Hathewaya histolytica OX=1498 GN=colH PE=1 SV=1
14	Q21FF1	0.088	39.7	3477	0.068	0.020	Q21FF1_SACD2 RTX toxins and related Ca2+-binding protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=Sde_3323 PE=1 SV=1
15	B6IDE6	0.16	38.5	3113	0.024	0.008	B6IDE6_DANRE FRAS1-related extracellular matrix protein 2 precursor OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
16	D7PS91	0.17	38.5	3119	0.024	0.008	D7PS91_DANRE FRAS1-related extracellular matrix 2a OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
17	O08852	0.35	37.7	4293	0.094	0.023	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
18	Q93LQ6	0.71	36.2	699	0.033	0.050	FLS_FERPE Fervidolysin OS=Fervidobacterium pennivorans OX=93466 GN=fls PE=1 SV=1
19	Q13332	1.2	35.8	1948	0.026	0.014	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
20	Q2PZL6	1.2	35.8	4981	0.060	0.013	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16561 AMPK1_CBM	2.1e+02	13.5	Glycogen recognition site of AMP-activated protein kinase
2	PF19077 Big_13	0.0015	30.3	Bacterial Ig-like domain
3	PF17963 Big_9	4.9e-05	35.3	Bacterial Ig domain
4	PF17892 Cadherin_5	4.4e+02	12.2	Cadherin-like domain
5	PF13585 CHU_C	3.4e+02	12.7	CHU_C Type IX secretion signal domain
6	PF04234 CopC	8.2e+02	12.5	CopC domain
7	PF15418 DUF4625	0.00014	33.5	Domain of unknown function (DUF4625)
8	PF16389 DUF4998	7.1	17.7	Domain of unknown function
9	PF16403 DUF5011	32	16.0	Domain of unknown function (DUF5011)
10	PF16405 DUF5013	2.6	19.6	Domain of unknown function (DUF5013)
11	PF10917 Fungus-induced	6.4e+02	12.1	Fungus-induced protein
12	PF20164 GspA_SrpA_N	5.1	18.9	GspA/SrpA SigLec-like domain
13	PF05345 He_PIG	0.36	22.7	Putative Ig domain
14	PF18981 InlK_D3	0.18	23.2	Internalin K domain (D3/D4)
15	PF00801 PKD	8.5e-09	46.5	PKD domain
16	PF18911 PKD_4	2.7e-21	86.7	PKD domain
17	PF13908 Shisa	22	16.6	Wnt and FGF inhibitory regulator
18	PF17747 VID27_PH	2.8e+02	13.2	VID27 PH-like domain
19	PF14524 Wzt_C	2.9	19.4	Wzt C-terminal domain
20	PF07495 Y_Y_Y	5.4e-08	44.0	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318406

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000043402	0.848	Reticulon-4 receptor
2	9606.ENSP00000464275	0.715	Protein Njmu-R1
3	9606.ENSP00000367715	0.712	Doublecortin domain-containing protein 2
4	9606.ENSP00000225719	0.711	M14 carboxypeptidases
5	9606.ENSP00000294258	0.700	Zinc finger protein-like 1
6	9606.ENSP00000316512	0.694	Serine/threonine-protein kinase tousled-like 2
7	9606.ENSP00000411099	0.687	Serine/threonine-protein kinase tousled-like 1
8	9606.ENSP00000386834	0.678	AF4/FMR2 family member 3
9	9606.ENSP00000253363	0.677	RNA-binding protein 39
10	9606.ENSP00000323275	0.665	Dynein assembly factor 4, axonemal
11	9606.ENSP00000333568	0.656	Serine/threonine-protein kinase D1
12	9606.ENSP00000335082	0.600	Protein FAM91A1
13	9606.ENSP00000482540	0.591	Zinc finger protein 658
14	9606.ENSP00000431984	0.559	Calpain-1 catalytic subunit
15	9606.ENSP00000261486	0.557	Erythrocyte membrane protein band 4.1 like 4A
16	9606.ENSP00000348472	0.556	PX domain-containing protein kinase-like protein
17	9606.ENSP00000318690	0.553	GC-rich sequence DNA-binding factor 2
18	9606.ENSP00000397925	0.546	Calcium-transporting ATPase type 2C member 2
19	9606.ENSP00000446100	0.541	C-Maf-inducing protein
20	9606.ENSP00000290524	0.539	DNA-binding protein RFX5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0032501	0.951	multicellular organismal process
GO:0016043	0.940	cellular component organization
GO:0030154	0.938	cell differentiation
GO:0007275	0.935	multicellular organism development
GO:0006996	0.909	organelle organization
GO:0051179	0.900	localization
GO:0048870	0.883	cell motility
GO:0050896	0.866	response to stimulus
GO:0016050	0.805	vesicle organization
GO:0006810	0.781	transport
GO:0061025	0.745	membrane fusion
GO:0097722	0.734	sperm motility
GO:0003341	0.692	cilium movement
GO:0050789	0.679	regulation of biological process
GO:0046718	0.662	viral entry into host cell
GO:0060285	0.661	cilium-dependent cell motility
GO:0032504	0.628	multicellular organism reproduction
GO:0060294	0.621	cilium movement involved in cell motility
GO:0048232	0.619	male gamete generation
GO:0010256	0.612	endomembrane system organization
GO:0048515	0.602	spermatid differentiation
GO:0050794	0.594	regulation of cellular process
GO:0007286	0.567	spermatid development
GO:0048731	0.524	system development
GO:0044085	0.514	cellular component biogenesis
GO:0030317	0.495	flagellated sperm motility
GO:0016192	0.464	vesicle-mediated transport
GO:0033363	0.461	secretory granule organization
GO:0007399	0.440	nervous system development
GO:0001764	0.362	neuron migration
GO:0022607	0.345	cellular component assembly
GO:0009605	0.338	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005794	1.000	Golgi apparatus
GO:0031981	1.000	nuclear lumen
GO:0005730	0.957	nucleolus
GO:0031982	0.842	vesicle
GO:0031410	0.726	cytoplasmic vesicle
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]