StarFunc result for job id Q8IZC4

User Input

>input (609 residues)
MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMV
CNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFS
NKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCC
TEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSAVFGVKYNLLAHTT
LTLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMVE
GLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKDAKKRIHNFSV
INPVPGQAITQIFAVDNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFL
TKEATSVYHDMSIDSPMKLESLTDIIQKKIEETNGQFLIGQHEESLPPPWATLFDGNHQM
VIQKKVLYPASEPLHDEKGKKRQAPLPPSDKLPFSLKSQSNTDQLVKDNWGKTSVSQTSS
LDTKLSTLMHHLQKPMAAPRKLLPARRNRLSDGEHTDTKTNFEAKPVPAPRQKSIKDILD
PRSWLQAQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZC4	1.000	1.000	0.000	609	1.000	1.000	Q8IZC4.pdb.gz	RTKN2_HUMAN Rhotekin-2 OS=Homo sapiens OX=9606 GN=RTKN2 PE=2 SV=1
2	AFDB:Q14B46	0.712	0.716	2.614E-81	604	0.718	0.724	Q14B46.pdb.gz	RTKN2_MOUSE Rhotekin-2 OS=Mus musculus OX=10090 GN=Rtkn2 PE=1 SV=2
3	AFDB:Q9BST9	0.603	0.651	5.793E-52	563	0.355	0.384	Q9BST9.pdb.gz	RTKN_HUMAN Rhotekin OS=Homo sapiens OX=9606 GN=RTKN PE=1 SV=2
4	AFDB:Q8C6B2	0.617	0.663	6.269E-50	564	0.330	0.356	Q8C6B2.pdb.gz	RTKN_MOUSE Rhotekin OS=Mus musculus OX=10090 GN=Rtkn PE=1 SV=3
5	AFDB:Q1LUB2	0.418	0.250	8.210E-20	1089	0.130	0.073	Q1LUB2.pdb.gz
6	AFDB:Q9V4P1	0.427	0.226	9.649E-20	1239	0.120	0.059	Q9V4P1.pdb.gz	ANLN_DROME Anillin OS=Drosophila melanogaster OX=7227 GN=scra PE=1 SV=3
7	PDB:5iz5B	0.158	0.131	6.927E-6	746	0.044	0.036	5iz5B.pdb.gz
8	PDB:5izrC	0.152	0.141	7.310E-6	659	0.044	0.041	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
9	PDB:5ixcA	0.154	0.139	9.067E-6	684	0.048	0.042	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	AFDB:X2JEA7	0.155	0.216	1.352E-5	420	0.103	0.150	X2JEA7.pdb.gz	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
11	AFDB:Q1LU99	0.141	0.088	2.581E-5	1083	0.128	0.072	Q1LU99.pdb.gz	RIPR2_DANRE Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1
12	AFDB:Q09459	0.140	0.071	2.874E-5	1322	0.133	0.061	Q09459.pdb.gz	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4
13	PDB:6bbpA	0.141	0.163	7.015E-5	520	0.039	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	AFDB:A0A5F8MPU3	0.188	0.058	9.395E-5	2282	0.107	0.028	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
15	PDB:5iz5A	0.154	0.127	9.690E-5	757	0.046	0.037	5iz5A.pdb.gz
16	PDB:6hhgA	0.144	0.220	1.139E-4	386	0.033	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:6u3eA	0.133	0.194	1.752E-4	397	0.030	0.045	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:6s9wA	0.148	0.214	1.951E-4	411	0.033	0.049	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:6kxkD	0.156	0.169	3.168E-4	553	0.059	0.065	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
20	PDB:3ljuX	0.147	0.233	3.528E-4	373	0.025	0.040	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14B46	0.0	910	604	0.729	0.735	RTKN2_MOUSE Rhotekin-2 OS=Mus musculus OX=10090 GN=Rtkn2 PE=1 SV=2
2	Q8IZC4	0.0	1270	609	1.000	1.000	RTKN2_HUMAN Rhotekin-2 OS=Homo sapiens OX=9606 GN=RTKN2 PE=2 SV=1
3	Q9BST9	2.33e-129	393	563	0.323	0.350	RTKN_HUMAN Rhotekin OS=Homo sapiens OX=9606 GN=RTKN PE=1 SV=2
4	Q8C6B2	1.64e-122	375	564	0.320	0.346	RTKN_MOUSE Rhotekin OS=Mus musculus OX=10090 GN=Rtkn PE=1 SV=3
5	Q8K298	1.03e-07	57.8	1121	0.133	0.072	ANLN_MOUSE Anillin OS=Mus musculus OX=10090 GN=Anln PE=1 SV=2
6	Q9NQW6	6.30e-05	48.5	1124	0.141	0.077	ANLN_HUMAN Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2
7	F1QJH8	0.001	44.3	1153	0.126	0.067	F1QJH8_DANRE Anillin OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
8	P39969	0.001	44.3	1040	0.049	0.029	BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI2 PE=1 SV=1
9	A0A286Y917	0.004	42.7	1171	0.126	0.066	A0A286Y917_DANRE Anillin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
10	Q9XTT4	0.009	41.6	1159	0.097	0.051	ANI1_CAEEL Anillin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=ani-1 PE=2 SV=2
11	Q9V4P1	0.016	40.8	1239	0.105	0.052	ANLN_DROME Anillin OS=Drosophila melanogaster OX=7227 GN=scra PE=1 SV=3
12	P54644	0.020	40.0	444	0.043	0.059	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
13	A0A1D8PRW9	0.053	39.3	1172	0.049	0.026	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1
14	Q90738	0.21	37.0	729	0.034	0.029	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
15	Q8N556	0.22	37.0	730	0.036	0.030	AFAP1_HUMAN Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2
16	E0AHA7	0.31	36.6	2326	0.048	0.012	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
17	Q9U9J8	0.31	36.6	2302	0.048	0.013	Q9U9J8_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
18	G5EG85	0.35	36.6	2257	0.048	0.013	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
19	Q9H4M7	0.39	36.2	779	0.051	0.040	PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2
20	Q8VH46	0.44	36.2	731	0.034	0.029	AFAP1_RAT Actin filament-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Afap1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08174 Anillin	3.6e-45	165.3	Cell division protein anillin
2	PF02185 HR1	11	17.5	Hr1 repeat
3	PF00169 PH	0.00019	33.3	PH domain
4	PF18326 RFX5_N	4.1e+02	12.1	RFX5 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362894

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335325	0.644	Coiled-coil domain containing 73
2	9606.ENSP00000444278	0.620	Transmembrane gamma-carboxyglutamic acid protein 1
3	9606.ENSP00000360381	0.607	CUB domain containing protein 2
4	9606.ENSP00000405252	0.601	A-kinase anchor protein 7 isoform gamma
5	9606.ENSP00000232978	0.590	NK-tumor recognition protein
6	9606.ENSP00000396441	0.586	G-patch domain containing 4
7	9606.ENSP00000312458	0.567	Protein ARV1
8	9606.ENSP00000482767	0.556	La-related protein 4B
9	9606.ENSP00000362942	0.545	Phosphatase and actin regulator 4
10	9606.ENSP00000483495	0.528	Probable ATP-dependent RNA helicase DDX27
11	9606.ENSP00000358813	0.515	Dual specificity protein kinase TTK
12	9606.ENSP00000017003	0.513	Xylosyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	0.981	GTPase regulator activity
GO:0140678	0.979	molecular function inhibitor activity
GO:0005095	0.954	GTPase inhibitor activity
GO:0019899	0.937	enzyme binding
GO:0031267	0.929	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.951	positive regulation of cellular process
GO:0080090	0.857	regulation of primary metabolic process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0031323	0.834	regulation of cellular metabolic process
GO:0051171	0.790	regulation of nitrogen compound metabolic process
GO:0048583	0.775	regulation of response to stimulus
GO:0019219	0.770	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.766	regulation of gene expression
GO:0009987	0.764	cellular process
GO:0009966	0.738	regulation of signal transduction
GO:1901222	0.640	regulation of NIK/NF-kappaB signaling
GO:0051252	0.608	regulation of RNA metabolic process
GO:0048523	0.517	negative regulation of cellular process
GO:0010556	0.513	regulation of macromolecule biosynthetic process
GO:0031326	0.513	regulation of cellular biosynthetic process
GO:2001141	0.398	regulation of RNA biosynthetic process
GO:0010941	0.342	regulation of cell death
GO:0009967	0.335	positive regulation of signal transduction
GO:0006355	0.334	regulation of DNA-templated transcription
GO:0065009	0.311	regulation of molecular function
GO:2001233	0.306	regulation of apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.989	nucleus
GO:0016020	0.837	membrane
GO:0005829	0.793	cytosol
GO:0071944	0.673	cell periphery
GO:0005886	0.425	plasma membrane
GO:0070013	0.362	intracellular organelle lumen
GO:0031981	0.309	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]