StarFunc result for job id Q8IZD2

User Input

>input (1858 residues)
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
INSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDITPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPV
SDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGNCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSNNGDGCA
SSNDNGEQVDHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTNECPSPDTSQNTCKSPPKMSKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVSASEAENGVHLKTELQQKQLSNNNQALSKNHPPQTHVRNSSEQLSQKLPSVPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLPANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSSYYQNQ
QPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHHQ
TAAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPPP
PPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALH
HPPHQGPPLFPSSAHPTVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGP
NSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UG20	0.196	0.195	0.000	1868	0.895	0.890	Q3UG20.pdb.gz	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
2	AFDB:Q8IZD2	1.000	1.000	0.000	1858	1.000	1.000	Q8IZD2.pdb.gz	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
3	AFDB:Q9C0A6	0.117	0.144	1.945E-50	1442	0.263	0.339	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
4	AFDB:Q9W5E0	0.067	0.090	3.542E-9	1300	0.101	0.144	Q9W5E0.pdb.gz	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
5	PDB:5hynA	0.063	0.193	7.401E-9	581	0.013	0.041	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
6	PDB:5wg6A	0.061	0.210	1.581E-8	517	0.016	0.056	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
7	PDB:7td5F	0.062	0.246	4.267E-8	447	0.013	0.054	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:7td5A	0.062	0.222	1.086E-7	497	0.013	0.048	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
9	PDB:6wkrC	0.061	0.182	1.151E-7	606	0.011	0.035	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
10	PDB:1pegA	0.064	0.383	1.221E-7	266	0.019	0.135	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
11	PDB:7ksoA	0.060	0.266	2.460E-7	395	0.012	0.058	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
12	AFDB:A2A7B5	0.060	0.065	2.826E-7	1709	0.126	0.138	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
13	AFDB:F1Q9U2	0.062	0.057	1.290E-6	2065	0.137	0.123	F1Q9U2.pdb.gz
14	AFDB:Q8C9B9	0.039	0.035	2.058E-6	2256	0.164	0.135	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
15	AFDB:Q9VU86	0.048	0.048	2.313E-6	1873	0.130	0.129	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
16	AFDB:Q13029	0.064	0.069	2.756E-6	1718	0.128	0.138	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
17	AFDB:Q9C0D2	0.034	0.026	1.414E-5	2601	0.144	0.103	Q9C0D2.pdb.gz	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
18	PDB:5h6zA	0.056	0.679	2.206E-5	123	0.010	0.146	5h6zA.pdb.gz
19	PDB:2g46A	0.055	0.615	1.348E-4	119	0.015	0.227	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5v3hA	0.034	0.118	4.750E-3	438	0.010	0.041	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UG20	0.0	3164	1868	0.893	0.888	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
2	Q8IZD2	0.0	3827	1858	1.000	1.000	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
3	E7EWN3	1.42e-172	566	1461	0.223	0.283	E7EWN3_HUMAN SET domain containing 5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=1
4	Q9C0A6	7.30e-166	547	1442	0.214	0.276	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
5	Q5XJV7	2.42e-160	532	1441	0.208	0.268	SETD5_MOUSE Histone-lysine N-methyltransferase SETD5 OS=Mus musculus OX=10090 GN=Setd5 PE=1 SV=2
6	H0Y3R4	1.40e-90	319	911	0.126	0.258	H0Y3R4_HUMAN SET domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=1
7	Q9VUB5	1.26e-50	201	3146	0.072	0.043	Q9VUB5_DROME UpSET, isoform A OS=Drosophila melanogaster OX=7227 GN=upSET PE=1 SV=3
8	Q10362	6.37e-22	105	859	0.049	0.106	SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set3 PE=1 SV=1
9	Q9NR48	2.69e-16	88.2	2969	0.022	0.013	ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens OX=9606 GN=ASH1L PE=1 SV=2
10	Q99MY8	4.09e-16	87.8	2958	0.022	0.014	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
11	Q9VW15	6.79e-13	77.0	2226	0.016	0.013	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
12	A0A8I5ZLS2	1.17e-11	72.8	2419	0.031	0.024	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
13	A0A8I6AUV5	1.17e-11	72.8	2426	0.031	0.024	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
14	E9Q5F9	1.35e-11	72.8	2537	0.031	0.023	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
15	A0A8I6A5I9	1.41e-11	72.8	2526	0.031	0.023	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
16	A0A8I6A709	1.49e-11	72.8	2520	0.031	0.023	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
17	A0A0G2KB10	1.59e-11	72.4	2523	0.031	0.023	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
18	D4A5H6	1.81e-11	72.4	2294	0.031	0.025	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
19	Q9BYW2	2.71e-11	71.6	2564	0.031	0.023	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
20	Q9VYD1	6.98e-11	70.5	2313	0.020	0.016	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	2e-05	35.7	PHD-finger
2	PF13831 PHD_2	1.4	19.7	PHD-finger
3	PF00856 SET	4.8e-05	35.3	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262519	0.945	Histone-lysine N-methyltransferase SETD1A
2	9606.ENSP00000442924	0.939	Histone-lysine N-methyltransferase SETD1B
3	9606.ENSP00000401946	0.926	Trinucleotide repeat-containing gene 6B protein
4	9606.ENSP00000217964	0.925	F-box-like/WD repeat-containing protein TBL1X
5	9606.ENSP00000476960	0.916	Histone cluster 2 H3 pseudogene 2
6	9606.ENSP00000379144	0.914	Trinucleotide repeat-containing gene 6A protein
7	9606.ENSP00000260356	0.911	Thrombospondin-1
8	9606.ENSP00000268712	0.906	Nuclear receptor corepressor 1
9	9606.ENSP00000399797	0.905	Putative helicase MOV-10
10	9606.ENSP00000362287	0.903	Protein argonaute-3
11	9606.ENSP00000362300	0.903	Protein argonaute-1
12	9606.ENSP00000362306	0.903	Protein argonaute-4
13	9606.ENSP00000329380	0.902	Platelet glycoprotein Ib alpha chain
14	9606.ENSP00000336783	0.902	Trinucleotide repeat-containing gene 6C protein
15	9606.ENSP00000384018	0.902	Nuclear receptor corepressor 2
16	9606.ENSP00000262407	0.900	Integrin alpha-IIb
17	9606.ENSP00000309555	0.892	Host cell factor 1
18	9606.ENSP00000362181	0.892	Natural cytotoxicity triggering receptor 2
19	9606.ENSP00000405574	0.890	F-box-like/WD repeat-containing protein TBL1XR1
20	9606.ENSP00000340896	0.852	Set1/Ash2 histone methyltransferase complex subunit ASH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0003713	1.000	transcription coactivator activity
GO:0035064	1.000	methylated histone binding
GO:0003824	0.863	catalytic activity
GO:0140096	0.820	catalytic activity, acting on a protein
GO:0016740	0.778	transferase activity
GO:0008168	0.550	methyltransferase activity
GO:0008276	0.484	protein methyltransferase activity
GO:0008757	0.480	S-adenosylmethionine-dependent methyltransferase activity
GO:0042054	0.427	histone methyltransferase activity
GO:0008170	0.426	N-methyltransferase activity
GO:0003682	0.342	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.987	positive regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0031326	0.979	regulation of cellular biosynthetic process
GO:0010468	0.976	regulation of gene expression
GO:0051252	0.974	regulation of RNA metabolic process
GO:0009893	0.967	positive regulation of metabolic process
GO:0031325	0.955	positive regulation of cellular metabolic process
GO:1903506	0.952	regulation of nucleic acid-templated transcription
GO:0045935	0.939	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.917	regulation of DNA-templated transcription
GO:0009987	0.915	cellular process
GO:0051726	0.913	regulation of cell cycle
GO:0010604	0.913	positive regulation of macromolecule metabolic process
GO:0045893	0.874	positive regulation of DNA-templated transcription
GO:1901987	0.871	regulation of cell cycle phase transition
GO:0071704	0.861	organic substance metabolic process
GO:1902806	0.853	regulation of cell cycle G1/S phase transition
GO:0044238	0.847	primary metabolic process
GO:0006807	0.835	nitrogen compound metabolic process
GO:0043170	0.800	macromolecule metabolic process
GO:0045787	0.771	positive regulation of cell cycle
GO:0090068	0.731	positive regulation of cell cycle process
GO:1901989	0.693	positive regulation of cell cycle phase transition
GO:2000045	0.668	regulation of G1/S transition of mitotic cell cycle
GO:0045931	0.606	positive regulation of mitotic cell cycle
GO:1902808	0.606	positive regulation of cell cycle G1/S phase transition
GO:0044237	0.565	cellular metabolic process
GO:1901992	0.466	positive regulation of mitotic cell cycle phase transition
GO:0043412	0.457	macromolecule modification
GO:0032501	0.427	multicellular organismal process
GO:0048519	0.386	negative regulation of biological process
GO:0048523	0.376	negative regulation of cellular process
GO:0019538	0.355	protein metabolic process
GO:0050896	0.330	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0000785	0.995	chromatin
GO:0016604	0.985	nuclear body
GO:0000791	0.981	euchromatin
GO:0005737	0.732	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.778	Transferases.
EC:2.1.1.-	0.550	Methyltransferases.

[back to server]