StarFunc result for job id Q8IZD4

User Input

>input (617 residues)
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLF
VYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEEC
QRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSE
PKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATC
QETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVR
SADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNLFEKLQ
STPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQ
AHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVL
AQSSGTGKPLESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKE
RESGLLPVGGQEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNII
YEAYLFSMTQAAMKKTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZD4	1.000	1.000	4.828E-88	617	1.000	1.000	Q8IZD4.pdb.gz	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
2	AFDB:Q3U564	0.391	0.413	1.845E-56	578	0.632	0.675	Q3U564.pdb.gz	DCP1B_MOUSE mRNA-decapping enzyme 1B OS=Mus musculus OX=10090 GN=Dcp1b PE=1 SV=1
3	AFDB:Q9NPI6	0.240	0.254	1.702E-28	582	0.287	0.304	Q9NPI6.pdb.gz	DCP1A_HUMAN mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3
4	AFDB:Q91YD3	0.243	0.249	2.032E-28	602	0.290	0.297	Q91YD3.pdb.gz	DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus OX=10090 GN=Dcp1a PE=1 SV=1
5	AFDB:Q9SJF3	0.212	0.351	2.774E-16	367	0.138	0.232	Q9SJF3.pdb.gz	DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g08370 PE=1 SV=2
6	PDB:6am0F	0.194	0.653	1.616E-12	178	0.053	0.185	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
7	PDB:2qkmG	0.185	0.858	4.965E-12	127	0.062	0.299	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
8	PDB:1q67B	0.173	0.643	1.717E-11	161	0.053	0.205	1q67B.pdb.gz
9	AFDB:Q8T4F7	0.173	0.113	4.771E-8	980	0.172	0.108	Q8T4F7.pdb.gz	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
10	PDB:3m1iB	0.166	0.701	2.613E-6	131	0.024	0.115	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
11	AFDB:Q12446	0.182	0.178	2.095E-5	633	0.186	0.182	Q12446.pdb.gz	LAS17_YEAST Proline-rich protein LAS17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS17 PE=1 SV=1
12	PDB:1k5dB	0.161	0.621	4.197E-5	146	0.019	0.082	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
13	AFDB:Q38AE6	0.120	0.066	4.257E-5	1203	0.167	0.086	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
14	AFDB:Q9QYY0	0.130	0.117	1.757E-4	695	0.141	0.125	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
15	AFDB:P91621	0.126	0.041	4.018E-4	2072	0.131	0.039	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
16	PDB:2kr0A	0.140	0.203	9.610E-4	407	0.042	0.064	2kr0A.pdb.gz
17	PDB:6oxlN	0.148	0.570	1.735E-3	124	0.032	0.161	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
18	PDB:6xtbE	0.107	0.235	2.623E-3	235	0.023	0.060	6xtbE.pdb.gz
19	PDB:4mk0A	0.131	0.128	3.323E-3	631	0.016	0.016	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:5yqrA	0.141	0.300	5.025E-3	268	0.019	0.045	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GZK9	0.0	775	390	0.619	0.979	F5GZK9_HUMAN Decapping mRNA 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=1
2	Q3U564	0.0	702	578	0.618	0.659	DCP1B_MOUSE mRNA-decapping enzyme 1B OS=Mus musculus OX=10090 GN=Dcp1b PE=1 SV=1
3	Q8IZD4	0.0	1263	617	1.000	1.000	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
4	Q9NPI6	2.39e-61	216	582	0.157	0.167	DCP1A_HUMAN mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3
5	A0A8I6APY3	6.79e-61	213	543	0.156	0.177	A0A8I6APY3_RAT 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase OS=Rattus norvegicus OX=10116 GN=Dcp1a PE=1 SV=1
6	D4AE80	1.92e-60	214	601	0.156	0.160	D4AE80_RAT 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase OS=Rattus norvegicus OX=10116 GN=Dcp1a PE=1 SV=1
7	Q91YD3	3.78e-60	213	602	0.154	0.158	DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus OX=10090 GN=Dcp1a PE=1 SV=1
8	Q9W1H5	3.76e-36	141	372	0.120	0.199	Q9W1H5_DROME Decapping protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=DCP1 PE=1 SV=1
9	Q9SJF3	5.95e-29	120	367	0.081	0.136	DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g08370 PE=1 SV=2
10	Q9P805	1.40e-15	75.9	127	0.062	0.299	DCP1_SCHPO mRNA-decapping enzyme subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcp1 PE=1 SV=1
11	Q9N363	1.55e-10	65.1	332	0.053	0.099	DCP1_CAEEL mRNA-decapping enzyme 1 OS=Caenorhabditis elegans OX=6239 GN=dcap-1 PE=1 SV=1
12	Q6CPV9	0.004	41.2	188	0.053	0.176	Q6CPV9_KLULA KLLA0E01827p OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0_E01827g PE=1 SV=1
13	C8ZHG8	0.21	36.2	231	0.023	0.061	C8ZHG8_YEAS8 Dcp1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=EC1118_1O4_0144g PE=3 SV=1
14	Q12517	0.21	36.2	231	0.023	0.061	DCP1_YEAST mRNA-decapping enzyme subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCP1 PE=1 SV=1
15	O95886	0.97	35.0	979	0.057	0.036	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
16	Q96UP3	6.0	32.3	1400	0.034	0.015	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06058 DCP1	1.4e-40	149.3	Dcp1-like decapping family
2	PF16741 mRNA_decap_C	8.8e-17	71.5	mRNA-decapping enzyme C-terminus
3	PF00568 WH1	72	14.8	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373715	0.999	m7GpppN-mRNA hydrolase
2	9606.ENSP00000320503	0.998	Enhancer of mRNA-decapping protein 3
3	9606.ENSP00000478754	0.997	Probable ATP-dependent RNA helicase DDX6
4	9606.ENSP00000351811	0.994	Enhancer of mRNA-decapping protein 4
5	9606.ENSP00000264951	0.986	5'-3' exoribonuclease 1
6	9606.ENSP00000300146	0.986	Protein PAT1 homolog 1
7	9606.ENSP00000310596	0.978	U6 snRNA-associated Sm-like protein LSm1
8	9606.ENSP00000469468	0.964	U6 snRNA-associated Sm-like protein LSm4
9	9606.ENSP00000476046	0.963	mRNA-decapping enzyme 1A
10	9606.ENSP00000302160	0.948	U6 snRNA-associated Sm-like protein LSm3
11	9606.ENSP00000364813	0.940	U6 snRNA-associated Sm-like protein LSm2
12	9606.ENSP00000410758	0.937	U6 snRNA-associated Sm-like protein LSm5
13	9606.ENSP00000422392	0.933	U6 snRNA-associated Sm-like protein LSm6
14	9606.ENSP00000252622	0.928	U6 snRNA-associated Sm-like protein LSm7
15	9606.ENSP00000446271	0.899	Protein LSM14 homolog A
16	9606.ENSP00000279068	0.867	Protein LSM14 homolog B
17	9606.ENSP00000362608	0.779	Serine/threonine-protein kinase pim-1
18	9606.ENSP00000380251	0.738	Nucleoside diphosphate-linked moiety X motif 19
19	9606.ENSP00000372169	0.726	Voltage-dependent calcium channel subunit alpha-2/delta-4
20	9606.ENSP00000362344	0.703	Folylpolyglutamate synthase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0033036	0.989	macromolecule localization
GO:0033365	0.963	protein localization to organelle
GO:0008152	0.867	metabolic process
GO:0071704	0.857	organic substance metabolic process
GO:0044238	0.839	primary metabolic process
GO:0044237	0.796	cellular metabolic process
GO:0006807	0.780	nitrogen compound metabolic process
GO:0043170	0.730	macromolecule metabolic process
GO:0050896	0.729	response to stimulus
GO:0050789	0.641	regulation of biological process
GO:0034641	0.575	cellular nitrogen compound metabolic process
GO:0006139	0.566	nucleobase-containing compound metabolic process
GO:0016070	0.557	RNA metabolic process
GO:0050794	0.512	regulation of cellular process
GO:0019222	0.489	regulation of metabolic process
GO:0060255	0.478	regulation of macromolecule metabolic process
GO:0010468	0.456	regulation of gene expression
GO:0051716	0.449	cellular response to stimulus
GO:0080090	0.432	regulation of primary metabolic process
GO:0031323	0.422	regulation of cellular metabolic process
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:0048519	0.419	negative regulation of biological process
GO:0048522	0.413	positive regulation of cellular process
GO:0070887	0.405	cellular response to chemical stimulus
GO:0010605	0.404	negative regulation of macromolecule metabolic process
GO:0071310	0.399	cellular response to organic substance
GO:0019219	0.359	regulation of nucleobase-containing compound metabolic process
GO:0071345	0.353	cellular response to cytokine stimulus
GO:0034504	0.350	protein localization to nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0043232	0.856	intracellular non-membrane-bounded organelle
GO:0005634	0.741	nucleus
GO:0070013	0.544	intracellular organelle lumen
GO:0099080	0.449	supramolecular complex
GO:0036464	0.303	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]