StarFunc result for job id Q8IZD9

User Input

>input (2030 residues)
MWTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKKPNVKGIFPAN
YIHLKKAIVSNRGQYETVVPLEDSIVTEVTATLQEWASLWKQLYVKHKVDLFYKLRHVMN
ELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKDFEVVDSDQISVSDL
YKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLY
DMREGKQISERFLVRLNKNGGPRNPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRML
LNDSKKGPPHLHYRRPYGCAVLSILDVLQSLTEVKEEKDFVLKVYTCNNESEWSQIHENI
IRKSSAKYSAPSASHGLIISLQLLRGDMEQIRRENPMIFNRGLAITRKLGFPDVIMPGDI
RNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLY
HSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDKGEKKLFGFAFSTLMRDDGTTLSD
DIHELYVYKCDENSTFNNHALYLGLPCCKEDYNGCPNIPSSLIFQRSTKESFFISTQLSS
TKLTQNVDLLALLKWKAFPDRIMDVLGRLRHVSGEEIVKFLQDILDTLFVILDDNTEKYG
LLVFQSLVFIINLLRDIKYFHFRPVMDTYIQKHFAGALAYKELIRCLKWYMDCSAELIRQ
DHIQEAMRALEYLFKFIVQSRILYSRATCGMEEEQFRSSIQELFQSIRFVLSLDSRNSET
LLFTQAALLNSFPTIFDELLQMFTVQEVAEFVRGTLGSMPSTVHIGQSMDVVKLQSIART
VDSRLFSFSESRRILLPVVLHHIHLHLRQQKELLICSGILGSIFSIVKTSSLEADVMEEV
EMMVESLLDVLLQTLLTIMSKSHAQEAVRGQRCPQCTAEITGEYVSCLLSLLRQMCDTHF
QHLLDNFQSKDELKEFLLKIFCVFRNLMKMSVFPRDWMVMRLLTSNIIVTTVQYLSSALH
KNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSM
WQNLGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELI
DKLDSMVSEGKGDESYRELFSLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERL
LDYRDCMKGEETENKKIGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFT
LLLYCELLQWEDRPLREFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQ
YESLYDYQSLSWIRKMEASYYDNIMEQQRLEPEFFRVGFYGRKFPFFLRNKEYVCRGHDY
ERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPD
RVKSFYRVNNVRKFRYDRPFHKGPKDKENEFKSLWIERTTLTLTHSLPGISRWFEVERRE
LVEVSPLENAIQVVENKNQELRSLISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQ
EAFFDKDYINKHPGDAEKITQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQ
MMRASLYHEFPGLDKLSPACSGTSTPRGNVLASHSPMSPESIKMTHRHSPMNLMGTGRHS
SSSLSSHASSEAGNMVMLGDGSMGDAPEDLYHHMQLAYPNPRYQGSVTNVSVLSSSQASP
SSSSLSSTHSAPSQMITSAPSSARGSPSLPDKYRHAREMMLLLPTYRDRPSSAMYPAAIL
ENGQPPNFQRALFQQVVGACKPCSDPNLSVAEKGHYSLHFDAFHHPLGDTPPALPARTLR
KSPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRTDTMDSMPSQ
AWNADEDLEPPYLPVHYSLSESAVLDSIKAQPCRSHSAPGCVIPQDPMDPPALPPKPYHP
RLPALEHDEGVLLREETERPRGLHRKAPLPPGSAKEEQARMAWEHGRGEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59764	0.768	0.787	0.000	1978	0.560	0.574	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
2	AFDB:Q8IZD9	1.000	1.000	0.000	2030	1.000	1.000	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
3	AFDB:Q92608	0.697	0.768	0.000	1830	0.333	0.369	Q92608.pdb.gz	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2
4	PDB:6tgbA	0.562	0.763	2.148E-60	1450	0.227	0.318	6tgbA.pdb.gz
5	AFDB:P29539	0.116	0.121	2.178E-12	1916	0.085	0.090	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
6	AFDB:Q5UIP0	0.123	0.108	3.674E-10	2472	0.089	0.073	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:Q6PR54	0.117	0.106	3.975E-10	2419	0.101	0.085	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
8	AFDB:E1C2U2	0.143	0.133	2.440E-9	2326	0.085	0.074	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
9	AFDB:F4J8G7	0.090	0.087	4.409E-9	2138	0.111	0.105	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
10	AFDB:F4IAT2	0.107	0.115	4.177E-8	1823	0.097	0.108	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
11	PDB:5itdA	0.070	0.135	1.493E-6	995	0.051	0.104	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	AFDB:O95996	0.102	0.092	6.016E-6	2303	0.105	0.093	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
13	PDB:6uqkA	0.071	0.071	1.723E-5	2054	0.097	0.096	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
14	PDB:6dr0C	0.071	0.071	2.766E-5	2193	0.079	0.073	6dr0C.pdb.gz	Structural basis for the regulation of inositol trisphosphate receptors by Ca2+and IP3.
15	PDB:5iz5B	0.068	0.146	2.993E-5	746	0.027	0.072	5iz5B.pdb.gz
16	PDB:5swpA	0.067	0.122	3.645E-5	1060	0.043	0.082	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	PDB:7mezA	0.066	0.131	4.618E-5	989	0.050	0.102	7mezA.pdb.gz
18	PDB:5gm6G	0.083	0.147	5.408E-5	875	0.042	0.097	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7owgB	0.073	0.070	6.852E-5	2152	0.067	0.063	7owgB.pdb.gz
20	PDB:7ajuUT	0.098	0.089	7.128E-5	2313	0.067	0.058	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096LNH6	1216	1886	0.332	0.357	A0A096LNH6_HUMAN Dedicator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=1
2	A0A0B4K7Q6	920	2008	0.307	0.311	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
3	A0A0B4KHD2	1328	2008	0.352	0.356	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
4	A0A590UJ51	860	898	0.229	0.518	A0A590UJ51_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
5	A8E1V6	1165	1866	0.332	0.361	A8E1V6_DANRE Dedicator of cytokinesis 1 OS=Danio rerio OX=7955 GN=dock1 PE=1 SV=1
6	A8E1V7	1102	1867	0.314	0.341	A8E1V7_DANRE Dedicator of cytokinesis 5 OS=Danio rerio OX=7955 GN=dock5 PE=1 SV=1
7	B2RY04	1141	1868	0.321	0.349	DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2
8	B7Z0R2	1328	2002	0.352	0.357	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
9	C9J637	763	849	0.204	0.489	C9J637_HUMAN Dedicator of cytokinesis 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=2
10	H0Y599	2165	1999	0.533	0.541	H0Y599_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
11	H0Y7N4	637	1090	0.191	0.356	H0Y7N4_HUMAN Dedicator of cytokinesis 5 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=1
12	P59764	2210	1978	0.542	0.557	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
13	Q14185	1220	1865	0.332	0.361	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
14	Q149N5	2185	2011	0.537	0.542	Q149N5_HUMAN DOCK4 protein OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
15	Q8BUR4	1217	1865	0.331	0.360	DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus OX=10090 GN=Dock1 PE=1 SV=3
16	Q8C3J5	1195	1828	0.327	0.363	DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3
17	Q8CIQ7	4147	2027	0.979	0.980	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
18	Q8IZD9	4235	2030	1.000	1.000	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
19	Q8MQY7	852	1543	0.266	0.349	Q8MQY7_DROME RE54856p OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
20	Q8N1I0	2177	1966	0.533	0.551	DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	3.8e-09	48.5	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	9.4e-16	69.0	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	2.6e-19	80.4	DHR-2, Lobe C
4	PF14429 DOCK-C2	7.5e-52	187.4	C2 domain in Dock180 and Zizimin proteins
5	PF16172 DOCK_N	1.8e-100	348.2	DOCK N-terminus
6	PF07653 SH3_2	0.13	23.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368759	0.977	Enhancer of filamentation 1
2	9606.ENSP00000312185	0.950	Engulfment and cell motility protein 1
3	9606.ENSP00000346671	0.938	Tyrosine-protein kinase Fyn
4	9606.ENSP00000377566	0.874	Engulfment and cell motility protein 3
5	9606.ENSP00000300574	0.873	Adapter molecule crk
6	9606.ENSP00000348461	0.839	Ras-related C3 botulinum toxin substrate 1
7	9606.ENSP00000320246	0.831	Sodium/hydrogen exchanger 9
8	9606.ENSP00000383118	0.821	Cell division control protein 42 homolog
9	9606.ENSP00000477455	0.772	Glutamate receptor ionotropic, NMDA 2B
10	9606.ENSP00000290246	0.763	Engulfment and cell motility protein 2
11	9606.ENSP00000302194	0.746	V-type proton ATPase subunit G 2
12	9606.ENSP00000277120	0.716	BDNF/NT-3 growth factors receptor
13	9606.ENSP00000346300	0.707	Crk-like protein
14	9606.ENSP00000376368	0.703	Wiskott-Aldrich syndrome protein family member 1
15	9606.ENSP00000379241	0.695	Leucine-rich repeat-containing protein 2
16	9606.ENSP00000412461	0.695	Rho GTPase-activating protein 22
17	9606.ENSP00000415434	0.694	Ubiquitin carboxyl-terminal hydrolase 40
18	9606.ENSP00000414303	0.689	Brain-derived neurotrophic factor
19	9606.ENSP00000367459	0.675	Dyslexia-associated protein KIAA0319
20	9606.ENSP00000263980	0.643	Sodium/hydrogen exchanger 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0048518	0.973	positive regulation of biological process
GO:0048583	0.971	regulation of response to stimulus
GO:0048522	0.920	positive regulation of cellular process
GO:1902531	0.918	regulation of intracellular signal transduction
GO:0051174	0.864	regulation of phosphorus metabolic process
GO:0050896	0.833	response to stimulus
GO:0042325	0.813	regulation of phosphorylation
GO:0065009	0.795	regulation of molecular function
GO:0060255	0.790	regulation of macromolecule metabolic process
GO:0043085	0.789	positive regulation of catalytic activity
GO:0080090	0.782	regulation of primary metabolic process
GO:0051171	0.782	regulation of nitrogen compound metabolic process
GO:0051716	0.768	cellular response to stimulus
GO:0051056	0.731	regulation of small GTPase mediated signal transduction
GO:0031399	0.682	regulation of protein modification process
GO:0001932	0.614	regulation of protein phosphorylation
GO:0051173	0.482	positive regulation of nitrogen compound metabolic process
GO:0010604	0.481	positive regulation of macromolecule metabolic process
GO:0031325	0.474	positive regulation of cellular metabolic process
GO:0071840	0.451	cellular component organization or biogenesis
GO:0051247	0.446	positive regulation of protein metabolic process
GO:0007154	0.433	cell communication
GO:0050730	0.421	regulation of peptidyl-tyrosine phosphorylation
GO:0016043	0.419	cellular component organization
GO:0023052	0.412	signaling
GO:0032501	0.380	multicellular organismal process
GO:0007165	0.373	signal transduction
GO:0001934	0.355	positive regulation of protein phosphorylation
GO:0032502	0.322	developmental process
GO:0048856	0.314	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.965	membrane
GO:0071944	0.944	cell periphery
GO:0043229	0.937	intracellular organelle
GO:0043227	0.897	membrane-bounded organelle
GO:0005886	0.877	plasma membrane
GO:0043231	0.819	intracellular membrane-bounded organelle
GO:0012505	0.640	endomembrane system
GO:0005634	0.616	nucleus
GO:0043228	0.499	non-membrane-bounded organelle
GO:0043232	0.483	intracellular non-membrane-bounded organelle
GO:0031981	0.384	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]