StarFunc result for job id Q8IZF0

User Input

>input (1738 residues)
MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDAAGGWQ
LVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVL
RVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTF
PRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILD
NLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRE
SFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDNKYIDQKLRKSVFSIRARNLL
EKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGK
SLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSC
ISMMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIF
IYLVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLV
SILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEK
KPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVFV
FLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFR
AKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVT
LKMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAIT
VLFRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLN
LLVAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGR
LEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLE
YTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPS
EDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPIS
HSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7cm3A	0.722	0.980	0.000	1278	0.734	0.998	7cm3A.pdb.gz
2	PDB:7sx3A	0.746	0.933	0.000	1386	0.796	0.998	7sx3A.pdb.gz	Structural architecture of the human NALCN channelosome.
3	PDB:7wjiC	0.749	0.929	0.000	1394	0.799	0.996	7wjiC.pdb.gz
4	AFDB:A8JUW5	0.802	0.627	0.000	2233	0.547	0.425	A8JUW5.pdb.gz	A8JUW5_DROME Narrow abdomen, isoform F OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=2
5	AFDB:G5EDM1	0.794	0.774	0.000	1785	0.458	0.446	G5EDM1.pdb.gz	G5EDM1_CAEEL Four domain-type voltage-gated ion channel alpha-1 subunit OS=Caenorhabditis elegans OX=6239 GN=nca-2 PE=2 SV=1
6	AFDB:Q8BXR5	0.863	0.863	0.000	1738	0.986	0.986	Q8BXR5.pdb.gz	NALCN_MOUSE Sodium leak channel NALCN OS=Mus musculus OX=10090 GN=Nalcn PE=1 SV=2
7	AFDB:Q9JIS7	0.614	0.543	4.511E-53	1985	0.202	0.177	Q9JIS7.pdb.gz	CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus OX=10090 GN=Cacna1f PE=1 SV=1
8	AFDB:Q7Z003	0.554	0.514	3.040E-44	1885	0.193	0.178	Q7Z003.pdb.gz	Q7Z003_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
9	PDB:7mixA	0.575	0.740	1.412E-43	1326	0.177	0.232	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
10	PDB:7vfsA	0.566	0.760	1.824E-43	1266	0.178	0.245	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
11	PDB:7w9lA	0.556	0.670	5.293E-43	1420	0.165	0.202	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
12	PDB:7xveA	0.516	0.690	1.817E-40	1276	0.151	0.206	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
13	PDB:7uhfA	0.571	0.787	7.106E-40	1230	0.174	0.246	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
14	PDB:7jpxA	0.539	0.816	4.256E-39	1116	0.163	0.254	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
15	PDB:7we4A	0.536	0.811	5.267E-39	1122	0.145	0.225	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
16	AFDB:Q9QX29	0.099	0.155	1.085E-3	975	0.065	0.116	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
17	AFDB:F4JHE9	0.053	0.066	1.661E-3	1185	0.087	0.128	F4JHE9.pdb.gz	F4JHE9_ARATH K+ efflux antiporter 2 OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=1
18	AFDB:D4A5F1	0.101	0.171	1.460E-2	966	0.044	0.080	D4A5F1.pdb.gz	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
19	AFDB:P10870	0.066	0.110	4.060E-2	884	0.059	0.115	P10870.pdb.gz	SNF3_YEAST Low glucose sensor SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF3 PE=1 SV=3
20	AFDB:Q59UQ6	0.035	0.076	8.029E-2	607	0.040	0.115	Q59UQ6.pdb.gz	Q59UQ6_CANAL Formin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HOF1 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8JUW5	0.0	1874	2233	0.548	0.427	A8JUW5_DROME Narrow abdomen, isoform F OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=2
2	G5EDM1	0.0	1480	1785	0.471	0.459	G5EDM1_CAEEL Four domain-type voltage-gated ion channel alpha-1 subunit OS=Caenorhabditis elegans OX=6239 GN=nca-2 PE=2 SV=1
3	G5EG32	0.0	1480	1763	0.471	0.465	G5EG32_CAEEL Four domain-type voltage-gated ion channel alpha-1 subunit OS=Caenorhabditis elegans OX=6239 GN=nca-2 PE=2 SV=1
4	Q688B2	0.0	1490	1861	0.457	0.427	Q688B2_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=1
5	Q688B3	0.0	1471	1767	0.442	0.435	Q688B3_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=2
6	Q688B4	0.0	1483	1827	0.450	0.428	Q688B4_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=2
7	Q6Q762	0.0	1488	1831	0.457	0.434	Q6Q762_CAEEL Four domain-type voltage-gated ion channel alpha-1 subunit OS=Caenorhabditis elegans OX=6239 GN=nca-1 PE=2 SV=2
8	Q8BXR5	0.0	3564	1738	0.987	0.987	NALCN_MOUSE Sodium leak channel NALCN OS=Mus musculus OX=10090 GN=Nalcn PE=1 SV=2
9	Q8I877	0.0	1868	1910	0.549	0.499	Q8I877_DROME Alpha1U protein OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=1
10	Q8IZF0	0.0	3606	1738	1.000	1.000	NALCN_HUMAN Sodium leak channel NALCN OS=Homo sapiens OX=9606 GN=NALCN PE=1 SV=1
11	Q8MXH5	0.0	1478	1801	0.449	0.433	Q8MXH5_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=2
12	R9PY25	0.0	1883	2224	0.548	0.428	R9PY25_DROME Narrow abdomen, isoform G OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=2
13	Q5A936	4.40e-73	274	2254	0.201	0.155	Q5A936_CANAL Cch1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCH1 PE=4 SV=1
14	O14234	3.71e-65	248	1854	0.110	0.104	CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cch1 PE=3 SV=1
15	Q5BE62	2.63e-63	242	2110	0.141	0.116	Q5BE62_EMENI Calcium channel OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01168 PE=4 SV=1
16	A0A8I5ZS49	8.45e-58	224	1973	0.123	0.108	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
17	A0A8I5ZMH8	9.04e-57	220	1960	0.122	0.108	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
18	G3V9W8	1.22e-56	220	1980	0.122	0.107	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
19	A1XIQ4	1.36e-56	220	1980	0.122	0.107	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
20	Q01815	2.40e-56	219	2139	0.112	0.091	CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus OX=10090 GN=Cacna1c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19299 DUF5914	2.7e+02	12.6	Domain of unknown function (DUF5914)
2	PF00520 Ion_trans	1.8e-134	458.1	Ion transport protein
3	PF08016 PKD_channel	0.0084	27.1	Polycystin cation channel
4	PF17550 PsaF	1.7e+02	13.2	Family of unknown function

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256339	0.998	Protein unc-79 homolog
2	9606.ENSP00000391088	0.997	Protein unc-80 homolog
3	9606.ENSP00000365080	0.939	Transmembrane protein FAM155A
4	9606.ENSP00000303522	0.774	Substance-P receptor
5	9606.ENSP00000256010	0.769	Neurotensin/neuromedin N
6	9606.ENSP00000364449	0.751	Serine/threonine-protein kinase SIK3
7	9606.ENSP00000321106	0.741	Protachykinin-1
8	9606.ENSP00000462701	0.690	Cadherin-8
9	9606.ENSP00000305976	0.676	Serine/threonine-protein kinase SIK2
10	9606.ENSP00000453508	0.664	Talin-2
11	9606.ENSP00000347244	0.656	Intersectin-2
12	9606.ENSP00000286628	0.631	Calcium-activated potassium channel subunit alpha-1
13	9606.ENSP00000485191	0.594	Olfactory receptor 4X2
14	9606.ENSP00000420194	0.566	Extracellular calcium-sensing receptor
15	9606.ENSP00000311605	0.556	Olfactory receptor 4B1
16	9606.ENSP00000376523	0.556	Sodium channel subunit beta-3
17	9606.ENSP00000316029	0.554	Talin-1
18	9606.ENSP00000353362	0.543	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
19	9606.ENSP00000278947	0.533	Sodium channel subunit beta-2
20	9606.ENSP00000359404	0.506	Involved in clathrin-mediated endocytosis at the synapse. Plays a role in neuronal development and in synaptic vesicle recycling in mature neurons, a process required for normal synaptic transmission.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901702	1.000	salt transmembrane transporter activity
GO:0046873	1.000	metal ion transmembrane transporter activity
GO:0005261	1.000	monoatomic cation channel activity
GO:0022836	0.864	gated channel activity
GO:0022839	0.827	monoatomic ion gated channel activity
GO:0005244	0.635	voltage-gated monoatomic ion channel activity
GO:0022843	0.600	voltage-gated monoatomic cation channel activity
GO:0005272	0.515	sodium channel activity
GO:0005262	0.476	calcium channel activity
GO:0005248	0.341	voltage-gated sodium channel activity
GO:0005245	0.302	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.979	transport
GO:0065007	0.975	biological regulation
GO:0006811	0.966	monoatomic ion transport
GO:0055085	0.963	transmembrane transport
GO:0034220	0.903	monoatomic ion transmembrane transport
GO:0050789	0.760	regulation of biological process
GO:0006812	0.628	monoatomic cation transport
GO:0098655	0.595	monoatomic cation transmembrane transport
GO:0098660	0.587	inorganic ion transmembrane transport
GO:0030001	0.564	metal ion transport
GO:0050794	0.480	regulation of cellular process
GO:0050896	0.455	response to stimulus
GO:0098662	0.430	inorganic cation transmembrane transport
GO:0032501	0.429	multicellular organismal process
GO:0065008	0.331	regulation of biological quality
GO:0042391	0.308	regulation of membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.648	intracellular anatomical structure
GO:0042995	0.484	cell projection
GO:0120025	0.461	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.515	Na(+)(in) = Na(+)(out)
RHEA:29671	0.476	Ca(2+)(in) = Ca(2+)(out)

[back to server]