StarFunc result for job id Q8IZF2

User Input

>input (1346 residues)
MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTA
EEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWC
SCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNV
GFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPS
LELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSS
NVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYE
CKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPI
SVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWN
GTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKV
TFHTGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSKTVDVCCHFTNAANNSVWSPSMKLN
LVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDC
ISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLL
STVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTM
AFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFR
LANNTGGWDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGV
GFSILSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYI
LCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPL
AISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRP
SIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKT
GTYNVSTPEATSSSLENSSSASSLLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E8Q8	0.528	0.527	0.000	1348	0.720	0.719	G5E8Q8.pdb.gz	AGRF5_MOUSE Adhesion G protein-coupled receptor F5 OS=Mus musculus OX=10090 GN=Adgrf5 PE=1 SV=1
2	AFDB:Q8IZF2	1.000	1.000	0.000	1346	1.000	1.000	Q8IZF2.pdb.gz	AGRF5_HUMAN Adhesion G protein-coupled receptor F5 OS=Homo sapiens OX=9606 GN=ADGRF5 PE=1 SV=3
3	AFDB:Q8IZF5	0.344	0.413	2.191E-50	1079	0.198	0.247	Q8IZF5.pdb.gz	AGRF3_HUMAN Adhesion G-protein coupled receptor F3 OS=Homo sapiens OX=9606 GN=ADGRF3 PE=2 SV=1
4	AFDB:Q5T601	0.265	0.370	2.735E-50	910	0.221	0.326	Q5T601.pdb.gz	AGRF1_HUMAN Adhesion G-protein coupled receptor F1 OS=Homo sapiens OX=9606 GN=ADGRF1 PE=1 SV=2
5	AFDB:Q8VEC3	0.244	0.349	5.321E-50	908	0.217	0.322	Q8VEC3.pdb.gz	AGRF1_MOUSE Adhesion G-protein coupled receptor F1 OS=Mus musculus OX=10090 GN=Adgrf1 PE=2 SV=2
6	AFDB:Q8IZF3	0.218	0.386	8.757E-38	695	0.165	0.319	Q8IZF3.pdb.gz	AGRF4_HUMAN Adhesion G protein-coupled receptor F4 OS=Homo sapiens OX=9606 GN=ADGRF4 PE=1 SV=3
7	AFDB:Q8IZF7	0.222	0.390	1.000E-37	708	0.162	0.308	Q8IZF7.pdb.gz	AGRF2_HUMAN Putative adhesion G protein-coupled receptor F2P OS=Homo sapiens OX=9606 GN=ADGRF2P PE=5 SV=1
8	AFDB:O95490	0.220	0.204	9.744E-34	1459	0.150	0.138	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
9	AFDB:O94910	0.210	0.193	1.659E-33	1474	0.143	0.131	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
10	AFDB:Q9Z173	0.219	0.193	3.856E-33	1550	0.175	0.152	Q9Z173.pdb.gz	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
11	PDB:1e07A	0.140	0.245	8.475E-13	642	0.058	0.121	1e07A.pdb.gz
12	PDB:7sqcO0	0.154	0.174	7.486E-11	1140	0.056	0.066	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:5oj2B	0.127	0.216	8.181E-11	692	0.056	0.110	5oj2B.pdb.gz
14	PDB:1igaA	0.073	0.170	1.739E-10	475	0.045	0.126	1igaA.pdb.gz
15	PDB:4aq1A	0.094	0.154	4.616E-10	721	0.048	0.090	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
16	PDB:6dldD	0.102	0.309	3.110E-9	269	0.036	0.178	6dldD.pdb.gz
17	PDB:2rcjC	0.111	0.212	5.067E-9	523	0.052	0.134	2rcjC.pdb.gz
18	PDB:1igtB	0.074	0.188	8.630E-9	444	0.038	0.115	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
19	PDB:6dlfA	0.097	0.339	2.735E-8	236	0.030	0.169	6dlfA.pdb.gz
20	PDB:1hzhH	0.079	0.164	3.731E-8	457	0.039	0.116	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E8Q8	0.0	1907	1348	0.721	0.720	AGRF5_MOUSE Adhesion G protein-coupled receptor F5 OS=Mus musculus OX=10090 GN=Adgrf5 PE=1 SV=1
2	Q8IZF2	0.0	2783	1346	1.000	1.000	AGRF5_HUMAN Adhesion G protein-coupled receptor F5 OS=Homo sapiens OX=9606 GN=ADGRF5 PE=1 SV=3
3	Q8IZF3	7.73e-105	350	695	0.178	0.345	AGRF4_HUMAN Adhesion G protein-coupled receptor F4 OS=Homo sapiens OX=9606 GN=ADGRF4 PE=1 SV=3
4	Q9D2L6	1.87e-104	349	698	0.173	0.334	AGRF4_MOUSE Adhesion G protein-coupled receptor F4 OS=Mus musculus OX=10090 GN=Adgrf4 PE=2 SV=2
5	Q5T601	1.62e-103	353	910	0.181	0.267	AGRF1_HUMAN Adhesion G-protein coupled receptor F1 OS=Homo sapiens OX=9606 GN=ADGRF1 PE=1 SV=2
6	Q8VEC3	5.77e-97	334	908	0.174	0.258	AGRF1_MOUSE Adhesion G-protein coupled receptor F1 OS=Mus musculus OX=10090 GN=Adgrf1 PE=2 SV=2
7	Q8IZF7	3.25e-95	324	708	0.151	0.287	AGRF2_HUMAN Putative adhesion G protein-coupled receptor F2P OS=Homo sapiens OX=9606 GN=ADGRF2P PE=5 SV=1
8	Q8IZF5	2.12e-80	290	1079	0.167	0.209	AGRF3_HUMAN Adhesion G-protein coupled receptor F3 OS=Homo sapiens OX=9606 GN=ADGRF3 PE=2 SV=1
9	Q6QNK2	2.48e-40	164	874	0.087	0.134	AGRD1_HUMAN Adhesion G-protein coupled receptor D1 OS=Homo sapiens OX=9606 GN=ADGRD1 PE=1 SV=1
10	Q9HAR2	1.53e-34	147	1447	0.073	0.068	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
11	Q9Z173	1.64e-34	147	1550	0.087	0.075	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
12	Q80TS3	1.87e-34	146	1537	0.074	0.065	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
13	O95490	4.54e-33	142	1459	0.070	0.064	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
14	Q80TR1	1.77e-31	137	1466	0.070	0.064	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
15	Q8JZZ7	2.07e-31	136	1487	0.115	0.104	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
16	O94910	2.11e-31	136	1474	0.070	0.064	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
17	O88917	2.48e-31	136	1515	0.070	0.062	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
18	Q9ESC1	2.49e-31	135	738	0.074	0.134	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1
19	Q8CJ11	2.59e-31	135	1013	0.085	0.114	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
20	Q9HBW9	1.29e-30	132	690	0.109	0.213	AGRL4_HUMAN Adhesion G protein-coupled receptor L4 OS=Homo sapiens OX=9606 GN=ADGRL4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	1.1e-29	115.0	7 transmembrane receptor (Secretin family)
2	PF16489 GAIN	0.026	25.4	GPCR-Autoproteolysis INducing (GAIN) domain
3	PF01825 GPS	1.7e-12	59.1	GPCR proteolysis site, GPS, motif
4	PF07679 I-set	2.2e-06	39.0	Immunoglobulin I-set domain
5	PF00047 ig	2.2e-06	39.1	Immunoglobulin domain
6	PF13895 Ig_2	0.00067	31.2	Immunoglobulin domain
7	PF13927 Ig_3	8.7e-12	56.8	Immunoglobulin domain
8	PF01390 SEA	1.9e-05	36.2	SEA domain
9	PF07686 V-set	0.017	26.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316152	0.918	Pulmonary surfactant-associated protein C
2	9606.ENSP00000386346	0.910	Pulmonary surfactant-associated protein B
3	9606.ENSP00000273859	0.626	Probable phospholipid-transporting ATPase VD
4	9606.ENSP00000376384	0.614	Adhesion G protein-coupled receptor A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050896	0.990	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0007165	0.978	signal transduction
GO:0007186	0.969	G protein-coupled receptor signaling pathway
GO:0032501	0.425	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043226	0.998	organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0005622	0.986	intracellular anatomical structure
GO:0005737	0.981	cytoplasm
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0031982	0.943	vesicle
GO:0031410	0.858	cytoplasmic vesicle
GO:0009986	0.646	cell surface
GO:0071944	0.554	cell periphery
GO:0005886	0.501	plasma membrane
GO:0012505	0.394	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]