StarFunc result for job id Q8IZF5

User Input

>input (1079 residues)
MVCSAAPLLLLATTLPLLGSPVAQASQPVSETGVRPREGLQRRQWGPLIGRDKAWNERID
RPFPACPIPLSSSFGRWPKGQTMWAQTSTLTLTEEELGQSQAGGESGSGQLLDQENGAGE
SALVSVYVHLDFPDKTWPPELSRTLTLPAASASSSPRPLLTGLRLTTECNVNHKGNFYCA
CLSGYQWNTSICLHYPPCQSLHNHQPCGCLVFSHPEPGYCQLLPPGSPVTCLPAVPGILN
LNSQLQMPGDTLSLTLHLSQEATNLSWFLRHPGSPSPILLQPGTQVSVTSSHGQAALSVS
NMSHHWAGEYMSCFEAQGFKWNLYEVVRVPLKATDVARLPYQLSISCATSPGFQLSCCIP
STNLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYACDLQSLGLAPLRVPIS
ITIIQDGDITCPEDASVLTWNVTKAGHVAQAPCPESKRGIVRRLCGADGVWGPVHSSCTD
ARLLALFTRTKLLQAGQGSPAEEVPQILAQLPGQAAEASSPSDLLTLLSTMKYVAKVVAE
ARIQLDRRALKNLLIATDKVLDMDTRSLWTLAQARKPWAGSTLLLAVETLACSLCPQDHP
FAFSLPNVLLQSQLFGPTFPADYSISFPTRPPLQAQIPRHSLAPLVRNGTEISITSLVLR
KLDHLLPSNYGQGLGDSLYATPGLVLVISIMAGDRAFSQGEVIMDFGNTDGSPHCVFWDH
SLFQGRGGWSKEGCQAQVASASPTAQCLCQHLTAFSVLMSPHTVPEEPALALLTQVGLGA
SILALLVCLGVYWLVWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFLSPGPRSPL
CLAAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLGYLCPLGLAGV
TLGLYLPQGQYLREGECWLDGKGGALYTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGP
PAEKRQALLGVIKALLILTPIFGLTWGLGLATLLEEVSTVPHYIFTILNTLQGVFILLFG
CLMDRKIQEALRKRFCRAQAPSSTISLVSCCLQILSCASKSMSEGIPWPSSEDMGTARS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZF5	1.000	1.000	0.000	1079	1.000	1.000	Q8IZF5.pdb.gz	AGRF3_HUMAN Adhesion G-protein coupled receptor F3 OS=Homo sapiens OX=9606 GN=ADGRF3 PE=2 SV=1
2	AFDB:Q5T601	0.473	0.552	1.416E-39	910	0.175	0.208	Q5T601.pdb.gz	AGRF1_HUMAN Adhesion G-protein coupled receptor F1 OS=Homo sapiens OX=9606 GN=ADGRF1 PE=1 SV=2
3	AFDB:Q9D2L6	0.361	0.524	7.615E-33	698	0.167	0.258	Q9D2L6.pdb.gz	AGRF4_MOUSE Adhesion G protein-coupled receptor F4 OS=Mus musculus OX=10090 GN=Adgrf4 PE=2 SV=2
4	AFDB:Q8IZF3	0.396	0.576	3.956E-32	695	0.161	0.250	Q8IZF3.pdb.gz	AGRF4_HUMAN Adhesion G protein-coupled receptor F4 OS=Homo sapiens OX=9606 GN=ADGRF4 PE=1 SV=3
5	AFDB:Q8IZF7	0.406	0.591	2.412E-29	708	0.145	0.220	Q8IZF7.pdb.gz	AGRF2_HUMAN Putative adhesion G protein-coupled receptor F2P OS=Homo sapiens OX=9606 GN=ADGRF2P PE=5 SV=1
6	AFDB:F1R8J2	0.352	0.209	2.998E-26	2014	0.130	0.070	F1R8J2.pdb.gz
7	AFDB:Q86SQ3	0.244	0.547	2.652E-15	457	0.095	0.225	Q86SQ3.pdb.gz	AGRE4_HUMAN Putative adhesion G protein-coupled receptor E4P OS=Homo sapiens OX=9606 GN=ADGRE4P PE=5 SV=1
8	PDB:7vqxR	0.209	0.571	1.308E-7	361	0.053	0.158	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
9	PDB:4k5yC	0.195	0.743	2.042E-7	248	0.049	0.214	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
10	PDB:7d3sR	0.205	0.733	2.668E-7	266	0.044	0.180	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
11	PDB:7tynR	0.211	0.563	3.644E-7	373	0.055	0.158	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
12	PDB:6wpwR	0.200	0.499	4.164E-7	398	0.048	0.131	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
13	PDB:7lciR	0.196	0.478	6.797E-7	393	0.047	0.130	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
14	PDB:3u7wL	0.091	0.352	8.878E-7	210	0.034	0.176	3u7wL.pdb.gz
15	PDB:7cz5R	0.199	0.703	9.283E-7	269	0.046	0.186	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
16	PDB:1gafL	0.101	0.379	1.061E-6	214	0.027	0.136	1gafL.pdb.gz	The immunological evolution of catalysis.
17	PDB:6vn7R	0.201	0.736	1.160E-6	263	0.044	0.183	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
18	AFDB:Q0E9F2	0.132	0.097	3.163E-5	1542	0.060	0.042	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
19	AFDB:A0A023GPK8	0.116	0.092	1.878E-4	1447	0.050	0.037	A0A023GPK8.pdb.gz	A0A023GPK8_DROME Friend of echinoid, isoform H OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
20	AFDB:Q9VS29	0.112	0.066	3.205E-4	2074	0.021	0.011	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZF5	0.0	2181	1079	1.000	1.000	AGRF3_HUMAN Adhesion G-protein coupled receptor F3 OS=Homo sapiens OX=9606 GN=ADGRF3 PE=2 SV=1
2	G5E8Q8	1.36e-81	293	1348	0.217	0.174	AGRF5_MOUSE Adhesion G protein-coupled receptor F5 OS=Mus musculus OX=10090 GN=Adgrf5 PE=1 SV=1
3	Q8IZF2	2.07e-80	290	1346	0.209	0.167	AGRF5_HUMAN Adhesion G protein-coupled receptor F5 OS=Homo sapiens OX=9606 GN=ADGRF5 PE=1 SV=3
4	Q9D2L6	2.14e-64	234	698	0.125	0.193	AGRF4_MOUSE Adhesion G protein-coupled receptor F4 OS=Mus musculus OX=10090 GN=Adgrf4 PE=2 SV=2
5	Q5T601	1.26e-63	235	910	0.172	0.204	AGRF1_HUMAN Adhesion G-protein coupled receptor F1 OS=Homo sapiens OX=9606 GN=ADGRF1 PE=1 SV=2
6	Q8IZF3	4.79e-62	227	695	0.150	0.233	AGRF4_HUMAN Adhesion G protein-coupled receptor F4 OS=Homo sapiens OX=9606 GN=ADGRF4 PE=1 SV=3
7	Q8VEC3	1.35e-56	214	908	0.171	0.203	AGRF1_MOUSE Adhesion G-protein coupled receptor F1 OS=Mus musculus OX=10090 GN=Adgrf1 PE=2 SV=2
8	Q8IZF7	6.19e-54	203	708	0.156	0.237	AGRF2_HUMAN Putative adhesion G protein-coupled receptor F2P OS=Homo sapiens OX=9606 GN=ADGRF2P PE=5 SV=1
9	Q9HAR2	4.65e-39	160	1447	0.154	0.115	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
10	O95490	1.50e-37	155	1459	0.157	0.116	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
11	Q80TS3	1.17e-36	153	1537	0.162	0.114	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
12	Q9Z173	3.49e-36	151	1550	0.162	0.113	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
13	Q80TR1	3.51e-35	148	1466	0.155	0.114	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
14	O94910	1.22e-34	146	1474	0.154	0.113	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
15	O88917	1.40e-34	146	1515	0.155	0.110	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
16	P48960	3.76e-34	144	835	0.098	0.127	AGRE5_HUMAN Adhesion G protein-coupled receptor E5 OS=Homo sapiens OX=9606 GN=ADGRE5 PE=1 SV=4
17	O88923	6.33e-34	144	1487	0.148	0.108	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
18	A0A2R8Q6E9	9.60e-33	140	1492	0.159	0.115	A0A2R8Q6E9_DANRE Adhesion G protein-coupled receptor L3 isoform X5 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
19	F1Q579	1.23e-32	140	1534	0.159	0.112	F1Q579_DANRE Adhesion G protein-coupled receptor L3 isoform X3 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=3
20	A0A2R8QM07	1.49e-32	140	1540	0.159	0.112	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	4.8e-28	109.7	7 transmembrane receptor (Secretin family)
2	PF04123 DUF373	1.1e+02	13.7	Domain of unknown function (DUF373)
3	PF18635 EpCAM_N	8.5e+02	11.5	Epithelial cell adhesion molecule N-terminal domain
4	PF16489 GAIN	0.013	26.4	GPCR-Autoproteolysis INducing (GAIN) domain
5	PF01825 GPS	1.1e-09	50.1	GPCR proteolysis site, GPS, motif
6	PF02793 HRM	0.011	27.4	Hormone receptor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376384	0.751	Adhesion G protein-coupled receptor A1
2	9606.ENSP00000363139	0.681	CD164 molecule like 2
3	9606.ENSP00000340596	0.509	Ubiquitin-protein ligase E3B
4	9606.ENSP00000386377	0.509	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.939	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0007186	0.985	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.726	plasma membrane
GO:0043226	0.399	organelle
GO:0043227	0.381	membrane-bounded organelle
GO:0043231	0.364	intracellular membrane-bounded organelle
GO:0005737	0.316	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]