StarFunc result for job id Q8IZF6

User Input

>input (1400 residues)
MKEHIIYQKLYGLILMSSFIFLSDTLSLKGKKLDFFGRGDTYVSLIDTIPELSRFTACID
LVFMDDNSRYWMAFSYITNNALLGREDIDLGLAGDHQQLILYRLGKTFSIRHHLASFQWH
TICLIWDGVKGKLELFLNKERILEVTDQPHNLTPHGTLFLGHFLKNESSEVKSMMRSFPG
SLYYFQLWDHILENEEFMKCLDGNIVSWEEDVWLVNKIIPTVDRTLRCFVPENMTIQEKS
TTVSQQIDMTTPSQITGVKPQNTAHSSTLLSQSIPIFATDYTTISYSNTTSPPLETMTAQ
KILKTLVDETATFAVDVLSTSSAISLPTQSISIDNTTNSMKKTKSPSSESTKTTKMVEAM
ATEIFQPPTPSNFLSTSRFTKNSVVSTTSAIKSQSAVTKTTSLFSTIESTSMSTTPCLKQ
KSTNTGALPISTAGQEFIESTAAGTVPWFTVEKTSPASTHVGTASSFPPEPVLISTAAPV
DSVFPRNQTAFPLATTDMKIAFTVHSLTLPTRLIETTPAPRTAETELTSTNFQDVSLPRV
EDAMSTSMSKETSSKTFSFLTSFSFTGTESVQTVIDAEATRTALTPEITLASTVAETMLS
STITGRVYTQNTPTADGHLLTLMSTRSASTSKAPESGPTSTTDEAAHLFSSNETIWTSRP
DQALLASMNTTTILTFVPNENFTSAFHENTTYTEYLSATTNITPLKASPEGKGTTANDAT
TARYTTAVSKLTSPWFANFSIVSGTTSITNMPEFKLTTLLLKTIPMSTKPANELPLTPRE
TVVPSVDIISTLACIQPNFSTEESASETTQTEINGAIVFGGTTTPVPKSATTQRLNATVT
RKEATSHYLMRKSTIAAVAEVSPFSTMLEVTDESAQRVTASVTVSSFPDIEKLSTPLDNK
TATTEVRESWLLTKLVKTTPRSSYNEMTEMFNFNHTYVAHWTSETSEGISAGSPTSGSTH
IFGEPLGASTTRISETSFSTTPTDRTATSLSDGILPPQPTAAHSSATPVPVTHMFSLPVN
GSSVVAEETEVTMSEPSTLARAFSTSVLSDVSNLSSTTMTTALVPPLDQTASTTIVIVPT
HGDLIRTTSEATVISVRKTSMAVPSLTETPFHSLRLSTPVTAKAETTLFSTSVDTVTPST
HTLVCSKPPPDNIPPASSTHVISTTSTPEATQPISQVEETSTYALSFPYTFSGGGVVASL
ATGTTETSVVDETTPSHISANKLTTSVNSHISSSATYRVHTPVSIQLVTSTSVLSSDKDQ
MTISLGKTPRTMEVTEMSPSKNSFISYSRGTPSLEMTDTGFPETTKISSHQTHSPSEIPL
GTPSDGNLASSPTSGSTQITPTLTSSNTVGVHIPEMSTSLGKTALPSQALTITTFLCPEK
ESTSALPAYTPRTVEMIVNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pbpB	0.126	0.766	3.364E-13	210	0.034	0.224	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
2	PDB:2a3wA	0.121	0.746	1.580E-12	204	0.034	0.230	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
3	PDB:7zl1A	0.120	0.710	2.326E-12	215	0.032	0.209	7zl1A.pdb.gz
4	PDB:1b09A	0.123	0.760	1.092E-11	206	0.026	0.175	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
5	PDB:7ufgA	0.117	0.140	7.821E-9	1151	0.026	0.031	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
6	AFDB:A0MSJ1	0.094	0.081	1.443E-8	1658	0.119	0.100	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
7	AFDB:Q9JLI2	0.098	0.082	1.703E-8	1739	0.142	0.114	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
8	AFDB:Q17RW2	0.108	0.090	1.902E-8	1714	0.136	0.111	Q17RW2.pdb.gz	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
9	PDB:7ufgB	0.115	0.135	2.361E-8	1182	0.022	0.026	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
10	AFDB:C7DZK3	0.087	0.070	3.305E-8	1783	0.143	0.112	C7DZK3.pdb.gz	CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio OX=7955 GN=col27a1a PE=2 SV=1
11	AFDB:Q8IZC6	0.090	0.069	4.865E-8	1860	0.141	0.106	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
12	AFDB:P12107	0.104	0.084	1.552E-7	1806	0.125	0.097	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
13	AFDB:Q9JI03	0.091	0.072	2.162E-7	1840	0.124	0.095	Q9JI03.pdb.gz	CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus OX=10116 GN=Col5a1 PE=1 SV=1
14	PDB:8a7eC	0.116	0.107	2.997E-7	1524	0.025	0.023	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	AFDB:F6T0B3	0.086	0.075	3.554E-7	1650	0.119	0.101	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
16	AFDB:Q30D77	0.096	0.079	4.433E-7	1733	0.131	0.106	Q30D77.pdb.gz	COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus OX=10090 GN=Col24a1 PE=2 SV=2
17	AFDB:O35206	0.089	0.091	4.951E-7	1367	0.137	0.140	O35206.pdb.gz	COFA1_MOUSE Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2
18	PDB:3v0aB	0.083	0.101	3.104E-5	1150	0.016	0.019	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:7qfqA	0.062	0.067	1.628E-4	1291	0.011	0.012	7qfqA.pdb.gz
20	PDB:5dg2B	0.076	0.575	2.677E-4	131	0.013	0.137	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZF6	0.0	2789	3080	1.000	0.455	AGRG4_HUMAN Adhesion G-protein coupled receptor G4 OS=Homo sapiens OX=9606 GN=ADGRG4 PE=1 SV=2
2	M9PC41	5.43e-20	100	22743	0.200	0.012	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
3	M9PB30	2.43e-19	97.8	22949	0.200	0.012	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
4	M9PBZ0	3.34e-19	97.4	22830	0.199	0.012	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PC45	6.22e-19	96.7	22300	0.199	0.013	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PEI1	7.35e-19	96.3	21657	0.199	0.013	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PB32	8.18e-19	96.3	19560	0.199	0.014	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PEH5	1.06e-18	95.9	20710	0.199	0.013	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	Q6TKP2	1.07e-06	55.8	672	0.036	0.074	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
10	O95502	1.73e-06	54.7	500	0.034	0.094	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
11	O35764	3.38e-06	53.9	494	0.035	0.099	NPTXR_RAT Neuronal pentraxin receptor OS=Rattus norvegicus OX=10116 GN=Nptxr PE=1 SV=1
12	F8VQB8	1.70e-05	51.6	469	0.036	0.109	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
13	H3BLN6	2.89e-05	50.4	372	0.034	0.126	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
14	Q99J85	3.18e-05	50.8	493	0.036	0.101	NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculus OX=10090 GN=Nptxr PE=1 SV=1
15	Q6TLW0	3.29e-05	50.4	469	0.036	0.107	Q6TLW0_MOUSE Neuronal pentraxin 1.4 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
16	Q6TLW1	4.92e-05	49.7	372	0.033	0.124	Q6TLW1_MOUSE Neuronal pentraxin 1.1 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
17	O70340	4.27e-04	47.0	429	0.034	0.112	NPTX2_MOUSE Neuronal pentraxin-2 OS=Mus musculus OX=10090 GN=Nptx2 PE=2 SV=1
18	P97738	5.66e-04	46.6	432	0.034	0.111	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
19	P47972	7.32e-04	46.2	431	0.034	0.111	NPTX2_HUMAN Neuronal pentraxin-2 OS=Homo sapiens OX=9606 GN=NPTX2 PE=1 SV=2
20	A8E4K4	0.001	45.4	432	0.030	0.097	A8E4K4_DANRE Neuronal pentraxin 2a precursor OS=Danio rerio OX=7955 GN=nptx2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02210 Laminin_G_2	1.1e+02	14.9	Laminin G domain
2	PF00354 Pentaxin	0.0027	28.9	Pentaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377699

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369344	0.747	Probable G-protein coupled receptor 150
2	9606.ENSP00000355319	0.688	CLOCK-interacting pacemaker
3	9606.ENSP00000360017	0.677	Zinc finger protein 280C
4	9606.ENSP00000437775	0.676	BCL-6 corepressor-like protein 1
5	9606.ENSP00000469332	0.674	Gamma-aminobutyric acid receptor subunit theta
6	9606.ENSP00000419786	0.638	Retrotransposon Gag-like protein 9
7	9606.ENSP00000403954	0.629	Teneurin-1
8	9606.ENSP00000407130	0.627	Zinc finger protein 410
9	9606.ENSP00000353850	0.605	Integrin beta-1-binding protein 1
10	9606.ENSP00000362390	0.587	T-box transcription factor TBX22
11	9606.ENSP00000354912	0.580	Melanoma-associated antigen E1
12	9606.ENSP00000055682	0.574	Neurite extension and migration factor
13	9606.ENSP00000218008	0.563	Protein ATP1B4
14	9606.ENSP00000384670	0.560	Acrosomal protein KIAA1210
15	9606.ENSP00000349689	0.559	Palmitoyltransferase ZDHHC9
16	9606.ENSP00000360147	0.558	Xaa-Pro aminopeptidase 2
17	9606.ENSP00000378635	0.558	Dystrophin-related protein 2
18	9606.ENSP00000331556	0.554	Cylicin-1
19	9606.ENSP00000262844	0.547	AMME syndrome candidate gene 1 protein
20	9606.ENSP00000258042	0.541	Neuromedin-B receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	0.999	G protein-coupled receptor activity
GO:0005488	0.994	binding
GO:0005515	0.927	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007186	0.981	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.462	cell periphery
GO:0005886	0.354	plasma membrane
GO:0005576	0.318	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]