StarFunc result for job id Q8IZH2

User Input

>input (1706 residues)
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKI
FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGE
TLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHK
IMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCA
PEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHL
HINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKW
FESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDET
EDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWY
YPYHYAPFLSDIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSP
IIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLM
CWYDRDTEFIYPSPWPEKFPAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFCGFP
TLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWP
HLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEH
YLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFD
SRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDAL
IQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFN
KKNEEVPGYTKKVGSEWMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGEN
ENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKKVRVTV
KPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLF
EVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVKPQPAVHQHSS
SSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQPTIQEKGAVL
PQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIEN
FLASLNISKENEVQSSHHGEPPSEEHLSPQSFAMGTRMLKEILKIDGSNTVDHKNEIKQI
ANEIPVSSNRRDEYGLPSQPKQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVS
TPVTELSRICSLVGMPQPDFSFLRMPQTMTVCQVKLSNGLLVHGPQCHSENEAKEKAALF
ALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTGWDHYGSNYALGAANIMPSSS
HLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKKRVANKKNFEN
KEAQSSQATPVQTSQPDSSNIVKVSPRESSSASLKSSPIAQPASSFQVETASQGHSISHH
KSTPISSSRRKSRKLAVNFGVSKPSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ABN8	0.757	0.750	0.000	1723	0.880	0.872	D4ABN8.pdb.gz	D4ABN8_RAT 5'-3' exoribonuclease 1 OS=Rattus norvegicus OX=10116 GN=Xrn1 PE=1 SV=2
2	AFDB:P22147	0.583	0.647	0.000	1528	0.270	0.301	P22147.pdb.gz	XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=XRN1 PE=1 SV=1
3	AFDB:Q8IZH2	1.000	1.000	0.000	1706	1.000	1.000	Q8IZH2.pdb.gz	XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1
4	AFDB:Q9BHK7	0.594	0.635	0.000	1591	0.314	0.337	Q9BHK7.pdb.gz	Q9BHK7_CAEEL 5'-3' exoribonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=xrn-1 PE=1 SV=3
5	PDB:7v6cB	0.038	0.245	1.607E-2	260	0.010	0.065	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
6	AFDB:Q90WE3	0.046	0.043	1.905E-2	1905	0.083	0.074	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
7	PDB:8dgaK	0.038	0.322	4.177E-2	182	0.009	0.088	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
8	PDB:7okyZ	0.027	0.078	5.648E-2	374	0.017	0.078	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
9	AFDB:Q9VWP5	0.038	0.032	6.694E-2	2486	0.077	0.053	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
10	PDB:6tedZ	0.025	0.060	9.338E-2	510	0.022	0.075	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
11	PDB:5datS4	0.023	0.090	1.033E-1	260	0.013	0.085	5datS4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:3j6b5	0.037	0.174	1.396E-1	326	0.011	0.055	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:7l08c	0.040	0.206	1.468E-1	289	0.010	0.059	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
14	PDB:7yz4A	0.038	0.052	1.795E-1	1234	0.008	0.011	7yz4A.pdb.gz
15	AFDB:Q9NP73	0.035	0.046	1.924E-1	1137	0.055	0.083	Q9NP73.pdb.gz	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
16	PDB:7yymA	0.037	0.049	1.985E-1	1281	0.010	0.013	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
17	PDB:7r97A	0.037	0.246	2.308E-1	226	0.010	0.075	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
18	AFDB:Q4LE39	0.052	0.061	4.090E-1	1312	0.084	0.109	Q4LE39.pdb.gz	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
19	AFDB:Q9BYP7	0.042	0.041	4.756E-1	1800	0.077	0.073	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
20	AFDB:A0A0R4IYD2	0.053	0.038	6.115E-1	2557	0.068	0.045	A0A0R4IYD2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PFP3	0.0	697	1504	0.275	0.312	A0A1D8PFP3_CANAL 5'-3' exoribonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEM1 PE=3 SV=1
2	A0A8I5XWP1	0.0	1263	969	0.351	0.617	A0A8I5XWP1_RAT 5'-3' exoribonuclease 1 OS=Rattus norvegicus OX=10116 GN=Xrn1 PE=1 SV=1
3	D4ABN8	0.0	3016	1723	0.880	0.872	D4ABN8_RAT 5'-3' exoribonuclease 1 OS=Rattus norvegicus OX=10116 GN=Xrn1 PE=1 SV=2
4	E1JJR3	0.0	915	1613	0.301	0.319	E1JJR3_DROME 5'-3' exoribonuclease 1 OS=Drosophila melanogaster OX=7227 GN=pcm PE=1 SV=1
5	H7C5E4	0.0	2388	1160	0.679	0.998	H7C5E4_HUMAN 5'-3' exoribonuclease 1 (Fragment) OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1
6	P97789	0.0	2989	1719	0.873	0.866	XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus OX=10090 GN=Xrn1 PE=1 SV=1
7	Q8IZH2	0.0	3567	1706	1.000	1.000	XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1
8	Q9BHK7	0.0	854	1591	0.298	0.319	Q9BHK7_CAEEL 5'-3' exoribonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=xrn-1 PE=1 SV=3
9	Q9VWI1	0.0	916	1612	0.301	0.319	Q9VWI1_DROME 5'-3' exoribonuclease 1 OS=Drosophila melanogaster OX=7227 GN=pcm PE=1 SV=1
10	Q9XZU2	0.0	846	1613	0.292	0.309	Q9XZU2_DROME 5'-3' exoribonuclease 1 OS=Drosophila melanogaster OX=7227 GN=pcm PE=2 SV=1
11	Q57XA6	4.23e-160	528	1418	0.232	0.279	Q57XA6_TRYB2 5'-3' exonuclease XRNA, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.100 PE=4 SV=1
12	A0A8I5ZUU8	1.56e-150	489	936	0.155	0.283	A0A8I5ZUU8_RAT 5'-3' exoribonuclease OS=Rattus norvegicus OX=10116 GN=Xrn2 PE=1 SV=1
13	Q9DBR1	5.83e-149	485	951	0.156	0.280	XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus OX=10090 GN=Xrn2 PE=1 SV=1
14	Q9H0D6	1.75e-148	483	950	0.159	0.285	XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1
15	D4A914	1.87e-148	483	951	0.156	0.280	D4A914_RAT 5'-3' exoribonuclease OS=Rattus norvegicus OX=10116 GN=Xrn2 PE=1 SV=3
16	A0A8I6A511	5.21e-142	464	915	0.150	0.280	A0A8I6A511_RAT 5'-3' exoribonuclease OS=Rattus norvegicus OX=10116 GN=Xrn2 PE=3 SV=1
17	Q9U299	3.11e-140	461	975	0.156	0.273	XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans OX=6239 GN=xrn-2 PE=1 SV=2
18	Q9VM71	3.03e-138	454	908	0.157	0.295	XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster OX=7227 GN=Rat1 PE=1 SV=2
19	Q9FQ02	3.69e-137	454	1012	0.154	0.259	XRN2_ARATH 5'-3' exoribonuclease 2 OS=Arabidopsis thaliana OX=3702 GN=XRN2 PE=1 SV=1
20	F4K1L3	6.95e-137	454	1023	0.154	0.256	F4K1L3_ARATH 5'-3' exoribonuclease OS=Arabidopsis thaliana OX=3702 GN=XRN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03368 Dicer_dimer	2.8e+02	13.0	Dicer dimerisation domain
2	PF18129 SH3_12	1.7e-15	68.2	Xrn1 SH3-like domain
3	PF18332 XRN1_D1	6.6e-31	119.1	Exoribonuclease Xrn1 D1 domain
4	PF18334 XRN1_D2_D3	0.0034	28.9	Exoribonuclease Xrn1 D2/D3 domain
5	PF18194 Xrn1_D3	0.19	23.3	Exoribonuclease 1 Domain-3
6	PF17846 XRN_M	2.3e-94	328.5	Xrn1 helical domain
7	PF03159 XRN_N	7.8e-91	315.5	XRN 5'-3' exonuclease N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300146	0.999	Protein PAT1 homolog 1
2	9606.ENSP00000302160	0.999	U6 snRNA-associated Sm-like protein LSm3
3	9606.ENSP00000310596	0.999	U6 snRNA-associated Sm-like protein LSm1
4	9606.ENSP00000373715	0.998	m7GpppN-mRNA hydrolase
5	9606.ENSP00000476046	0.998	mRNA-decapping enzyme 1A
6	9606.ENSP00000364813	0.995	U6 snRNA-associated Sm-like protein LSm2
7	9606.ENSP00000410758	0.995	U6 snRNA-associated Sm-like protein LSm5
8	9606.ENSP00000422392	0.995	U6 snRNA-associated Sm-like protein LSm6
9	9606.ENSP00000469468	0.995	U6 snRNA-associated Sm-like protein LSm4
10	9606.ENSP00000252622	0.994	U6 snRNA-associated Sm-like protein LSm7
11	9606.ENSP00000366396	0.989	5'-3' exoribonuclease 2
12	9606.ENSP00000161863	0.987	Probable ATP-dependent RNA helicase YTHDC2
13	9606.ENSP00000320503	0.987	Enhancer of mRNA-decapping protein 3
14	9606.ENSP00000280665	0.986	mRNA-decapping enzyme 1B
15	9606.ENSP00000470142	0.979	Regulator of nonsense transcripts 1
16	9606.ENSP00000364543	0.976	Helicase SKI2W
17	9606.ENSP00000351811	0.974	Enhancer of mRNA-decapping protein 4
18	9606.ENSP00000366135	0.961	Exosome component 10
19	9606.ENSP00000366997	0.957	Exosome complex exonuclease RRP44
20	9606.ENSP00000478754	0.957	Probable ATP-dependent RNA helicase DDX6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004534	1.000	5'-3' RNA exonuclease activity
GO:0070034	0.924	telomerase RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.975	regulation of biological process
GO:0044237	0.970	cellular metabolic process
GO:0071704	0.968	organic substance metabolic process
GO:0044238	0.967	primary metabolic process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0043170	0.954	macromolecule metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0034641	0.928	cellular nitrogen compound metabolic process
GO:0010468	0.924	regulation of gene expression
GO:0048519	0.915	negative regulation of biological process
GO:0010605	0.885	negative regulation of macromolecule metabolic process
GO:0051171	0.880	regulation of nitrogen compound metabolic process
GO:0080090	0.879	regulation of primary metabolic process
GO:0048523	0.879	negative regulation of cellular process
GO:0031323	0.879	regulation of cellular metabolic process
GO:0010556	0.848	regulation of macromolecule biosynthetic process
GO:0031326	0.847	regulation of cellular biosynthetic process
GO:0090304	0.818	nucleic acid metabolic process
GO:0010629	0.817	negative regulation of gene expression
GO:0016070	0.786	RNA metabolic process
GO:0031324	0.753	negative regulation of cellular metabolic process
GO:0044260	0.751	cellular macromolecule metabolic process
GO:0051172	0.751	negative regulation of nitrogen compound metabolic process
GO:0034655	0.542	nucleobase-containing compound catabolic process
GO:0010467	0.532	gene expression
GO:0006401	0.529	RNA catabolic process
GO:0016071	0.414	mRNA metabolic process
GO:0019219	0.408	regulation of nucleobase-containing compound metabolic process
GO:0006417	0.406	regulation of translation
GO:0010558	0.387	negative regulation of macromolecule biosynthetic process
GO:0031327	0.385	negative regulation of cellular biosynthetic process
GO:0071840	0.314	cellular component organization or biogenesis
GO:0050896	0.311	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0099080	0.975	supramolecular complex
GO:0036464	0.970	cytoplasmic ribonucleoprotein granule
GO:0016020	0.967	membrane
GO:0000932	0.953	P-body
GO:0005886	0.941	plasma membrane
GO:0032991	0.859	protein-containing complex
GO:0043231	0.825	intracellular membrane-bounded organelle
GO:0005634	0.677	nucleus
GO:0070013	0.486	intracellular organelle lumen
GO:0031981	0.470	nuclear lumen
GO:0005654	0.442	nucleoplasm
GO:0120025	0.341	plasma membrane bounded cell projection
GO:0030054	0.313	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.-	1.000	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]