StarFunc result for job id Q8IZJ0

User Input

>input (200 residues)
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZJ0	1.000	1.000	2.492E-28	200	1.000	1.000	Q8IZJ0.pdb.gz	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
2	AFDB:Q8IU54	0.781	0.781	7.660E-20	200	0.695	0.695	Q8IU54.pdb.gz	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
3	PDB:5t5wC	0.741	0.977	1.388E-17	151	0.700	0.927	5t5wC.pdb.gz
4	AFDB:F1PY54	0.788	0.829	2.859E-17	190	0.625	0.658	F1PY54.pdb.gz	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
5	AFDB:Q4VK74	0.761	0.787	1.084E-16	193	0.635	0.658	Q4VK74.pdb.gz	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
6	PDB:3og6A	0.685	0.954	8.077E-15	143	0.580	0.811	3og6A.pdb.gz
7	AFDB:B4ER10	0.718	0.769	2.644E-10	186	0.325	0.349	B4ER10.pdb.gz	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
8	AFDB:Q76KA5	0.452	0.459	2.834E-3	196	0.150	0.153	Q76KA5.pdb.gz
9	PDB:3pivB	0.378	0.458	6.150E-2	157	0.130	0.166	3pivB.pdb.gz
10	PDB:6weoQ	0.442	0.577	9.589E-2	142	0.125	0.176	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
11	AFDB:P20607	0.334	0.323	9.901E-2	211	0.175	0.166	P20607.pdb.gz	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
12	AFDB:Q90YI0	0.373	0.329	1.040E-1	241	0.160	0.133	Q90YI0.pdb.gz	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
13	AFDB:R9XMN7	0.469	0.496	1.704E-1	187	0.135	0.144	R9XMN7.pdb.gz	R9XMN7_CANLF Interferon 1EA OS=Canis lupus familiaris OX=9615 GN=IF1EA PE=2 SV=1
14	PDB:1wu3I	0.356	0.410	2.573E-1	161	0.135	0.168	1wu3I.pdb.gz
15	PDB:1ykbD	0.454	0.595	2.573E-1	142	0.120	0.169	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
16	AFDB:P05231	0.330	0.316	3.236E-1	212	0.115	0.108	P05231.pdb.gz	IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 PE=1 SV=1
17	PDB:6gg1A	0.463	0.606	3.635E-1	145	0.095	0.131	6gg1A.pdb.gz
18	PDB:1itfA	0.328	0.377	5.135E-1	165	0.140	0.170	1itfA.pdb.gz
19	PDB:7z0lB	0.402	0.245	5.667E-1	370	0.115	0.062	7z0lB.pdb.gz
20	PDB:1cnt2	0.279	0.368	6.904E-1	130	0.120	0.185	1cnt2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZJ0	9.80e-146	405	200	1.000	1.000	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
2	Q8IZI9	2.70e-135	378	196	0.940	0.959	IFNL3_HUMAN Interferon lambda-3 OS=Homo sapiens OX=9606 GN=IFNL3 PE=1 SV=2
3	Q8IU54	8.48e-89	261	200	0.665	0.665	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
4	Q4VK74	4.67e-74	223	193	0.600	0.622	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
5	F1PY54	4.04e-72	218	190	0.590	0.621	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
6	Q8CGK6	1.88e-67	206	193	0.565	0.585	IFNL3_MOUSE Interferon lambda-3 OS=Mus musculus OX=10090 GN=Ifnl3 PE=2 SV=1
7	B4ER10	3.05e-29	108	186	0.330	0.355	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
8	K9M1U5	0.10	34.7	179	0.220	0.246	IFNL4_HUMAN Interferon lambda-4 OS=Homo sapiens OX=9606 GN=IFNL4 PE=2 SV=1
9	Q9VCP0	0.59	33.1	643	0.175	0.054	ELOA1_DROME Transcription elongation factor B polypeptide 3 OS=Drosophila melanogaster OX=7227 GN=EloA PE=1 SV=1
10	Q582U7	1.7	31.6	332	0.075	0.045	Q582U7_TRYB2 RING-type E3 ubiquitin transferase (cysteine targeting) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.580 PE=3 SV=1
11	Q95Z07	1.7	31.6	332	0.075	0.045	Q95Z07_9TRYP RING-type E3 ubiquitin transferase (cysteine targeting) OS=Trypanosoma brucei OX=5691 GN=PEX2 PE=3 SV=1
12	Q6DT37	3.2	31.2	1551	0.160	0.021	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
13	F7IXA3	5.8	30.0	357	0.085	0.048	F7IXA3_RAT Zinc finger and BTB domain containing 16 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15177 IL28A	7.4e-71	248.6	Interleukin-28A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333639

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327824	0.979	Interferon lambda receptor 1
2	9606.ENSP00000290200	0.961	Interleukin-10 receptor subunit beta
3	9606.ENSP00000409000	0.864	Interferon lambda-3
4	9606.ENSP00000270139	0.858	Interferon alpha/beta receptor 1
5	9606.ENSP00000343957	0.835	Interferon alpha/beta receptor 2
6	9606.ENSP00000296980	0.806	Interleukin-22 receptor subunit alpha-2
7	9606.ENSP00000431885	0.793	Non-receptor tyrosine-protein kinase TYK2
8	9606.ENSP00000343204	0.786	Tyrosine-protein kinase JAK1
9	9606.ENSP00000314976	0.785	Interleukin-20 receptor subunit alpha
10	9606.ENSP00000356713	0.772	Interferon gamma receptor 1
11	9606.ENSP00000270800	0.758	Interleukin-22 receptor subunit alpha-1
12	9606.ENSP00000290219	0.758	Interferon gamma receptor 2
13	9606.ENSP00000328133	0.749	Interleukin-20 receptor subunit beta
14	9606.ENSP00000227752	0.746	Interleukin-10 receptor subunit alpha
15	9606.ENSP00000276927	0.711	Interferon alpha-1/13
16	9606.ENSP00000369581	0.710	Interferon beta
17	9606.ENSP00000370698	0.686	Interleukin-6 receptor subunit beta
18	9606.ENSP00000229134	0.681	Interleukin-26
19	9606.ENSP00000470788	0.667	Interleukin-12 receptor subunit beta-1
20	9606.ENSP00000321345	0.650	Interleukin-23 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032003	1.000	interleukin-28 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0048583	0.977	regulation of response to stimulus
GO:0010647	0.952	positive regulation of cell communication
GO:0009966	0.952	regulation of signal transduction
GO:0048523	0.948	negative regulation of cellular process
GO:0023056	0.933	positive regulation of signaling
GO:0009605	0.928	response to external stimulus
GO:0009607	0.926	response to biotic stimulus
GO:0006950	0.922	response to stress
GO:1904892	0.908	regulation of receptor signaling pathway via STAT
GO:0051707	0.898	response to other organism
GO:0042127	0.895	regulation of cell population proliferation
GO:0009967	0.870	positive regulation of signal transduction
GO:0006952	0.864	defense response
GO:0098542	0.851	defense response to other organism
GO:0009615	0.829	response to virus
GO:0009987	0.796	cellular process
GO:0019222	0.741	regulation of metabolic process
GO:0051607	0.711	defense response to virus
GO:0046425	0.695	regulation of receptor signaling pathway via JAK-STAT
GO:1904894	0.651	positive regulation of receptor signaling pathway via STAT
GO:0051716	0.648	cellular response to stimulus
GO:0002376	0.587	immune system process
GO:0009893	0.551	positive regulation of metabolic process
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0002682	0.533	regulation of immune system process
GO:0007154	0.516	cell communication
GO:0046427	0.516	positive regulation of receptor signaling pathway via JAK-STAT
GO:0023052	0.515	signaling
GO:0006955	0.489	immune response
GO:0007165	0.481	signal transduction
GO:0007166	0.453	cell surface receptor signaling pathway
GO:0051239	0.442	regulation of multicellular organismal process
GO:0031323	0.438	regulation of cellular metabolic process
GO:0010468	0.435	regulation of gene expression
GO:0010604	0.414	positive regulation of macromolecule metabolic process
GO:0002684	0.409	positive regulation of immune system process
GO:0050865	0.392	regulation of cell activation
GO:0080090	0.389	regulation of primary metabolic process
GO:0051171	0.389	regulation of nitrogen compound metabolic process
GO:0031325	0.387	positive regulation of cellular metabolic process
GO:0008285	0.380	negative regulation of cell population proliferation
GO:0042325	0.356	regulation of phosphorylation
GO:0042327	0.338	positive regulation of phosphorylation
GO:0031399	0.333	regulation of protein modification process
GO:0051173	0.306	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.635	cell periphery
GO:0005886	0.626	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]