StarFunc result for job id Q8IZJ1

User Input

>input (945 residues)
MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSL
KVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IE04	0.754	0.758	0.000	940	0.671	0.674	A0A0R4IE04.pdb.gz
2	AFDB:O08721	0.416	0.437	0.000	898	0.520	0.547	O08721.pdb.gz	UNC5A_RAT Netrin receptor UNC5A OS=Rattus norvegicus OX=10116 GN=Unc5a PE=1 SV=1
3	AFDB:O08722	0.443	0.443	0.000	945	0.919	0.919	O08722.pdb.gz	UNC5B_RAT Netrin receptor UNC5B OS=Rattus norvegicus OX=10116 GN=Unc5b PE=1 SV=1
4	AFDB:Q8K1S2	0.404	0.399	0.000	956	0.538	0.531	Q8K1S2.pdb.gz	UNC5D_MOUSE Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1
5	AFDB:Q6ZN44	0.412	0.461	1.097E-102	842	0.478	0.537	Q6ZN44.pdb.gz	UNC5A_HUMAN Netrin receptor UNC5A OS=Homo sapiens OX=9606 GN=UNC5A PE=1 SV=3
6	AFDB:Q26261	0.374	0.384	4.018E-72	919	0.269	0.276	Q26261.pdb.gz	UNC5_CAEEL Netrin receptor unc-5 OS=Caenorhabditis elegans OX=6239 GN=unc-5 PE=1 SV=3
7	AFDB:Q8WZ75	0.178	0.169	5.152E-19	1007	0.120	0.112	Q8WZ75.pdb.gz	ROBO4_HUMAN Roundabout homolog 4 OS=Homo sapiens OX=9606 GN=ROBO4 PE=1 SV=1
8	AFDB:Q8C310	0.179	0.169	8.174E-19	1012	0.110	0.103	Q8C310.pdb.gz	ROBO4_MOUSE Roundabout homolog 4 OS=Mus musculus OX=10090 GN=Robo4 PE=1 SV=2
9	AFDB:F1R9L1	0.092	0.082	4.101E-14	1078	0.094	0.083	F1R9L1.pdb.gz	F1R9L1_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=3
10	AFDB:Q9VPZ7	0.200	0.148	9.808E-14	1342	0.111	0.078	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
11	PDB:6feyB	0.082	0.327	1.593E-8	207	0.049	0.222	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
12	PDB:6dlfA	0.116	0.333	2.528E-8	236	0.040	0.161	6dlfA.pdb.gz
13	PDB:1e07A	0.132	0.177	2.801E-8	642	0.091	0.134	1e07A.pdb.gz
14	PDB:6dldD	0.118	0.301	1.010E-7	269	0.049	0.171	6dldD.pdb.gz
15	PDB:6feyD	0.084	0.457	1.869E-7	160	0.038	0.225	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
16	PDB:5oj2B	0.119	0.151	6.737E-7	692	0.053	0.072	5oj2B.pdb.gz
17	PDB:5c6wJ	0.089	0.331	1.978E-6	238	0.035	0.139	5c6wJ.pdb.gz
18	PDB:1w0rA	0.073	0.142	7.132E-6	442	0.070	0.149	1w0rA.pdb.gz
19	PDB:1hzhH	0.093	0.175	1.021E-5	457	0.046	0.094	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:3t5oA	0.084	0.091	1.389E-5	871	0.028	0.030	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JR35	0.0	1288	940	0.666	0.669	A9JR35_DANRE Netrin receptor UNC5 OS=Danio rerio OX=7955 GN=unc5h2 PE=1 SV=1
2	F1QXJ7	0.0	1273	929	0.661	0.673	F1QXJ7_DANRE Netrin receptor UNC5 OS=Danio rerio OX=7955 GN=sb:eu495 PE=3 SV=2
3	O08721	0.0	947	898	0.528	0.556	UNC5A_RAT Netrin receptor UNC5A OS=Rattus norvegicus OX=10116 GN=Unc5a PE=1 SV=1
4	O08722	0.0	1773	945	0.919	0.919	UNC5B_RAT Netrin receptor UNC5B OS=Rattus norvegicus OX=10116 GN=Unc5b PE=1 SV=1
5	O08747	0.0	1237	931	0.647	0.656	UNC5C_MOUSE Netrin receptor UNC5C OS=Mus musculus OX=10090 GN=Unc5c PE=1 SV=1
6	O95185	0.0	1224	931	0.635	0.644	UNC5C_HUMAN Netrin receptor UNC5C OS=Homo sapiens OX=9606 GN=UNC5C PE=1 SV=2
7	Q6UXZ4	0.0	984	953	0.525	0.520	UNC5D_HUMAN Netrin receptor UNC5D OS=Homo sapiens OX=9606 GN=UNC5D PE=1 SV=1
8	Q6ZN44	0.0	766	842	0.461	0.518	UNC5A_HUMAN Netrin receptor UNC5A OS=Homo sapiens OX=9606 GN=UNC5A PE=1 SV=3
9	Q7T2Z5	0.0	1215	931	0.628	0.637	UNC5C_CHICK Netrin receptor UNC5C OS=Gallus gallus OX=9031 GN=UNC5C PE=2 SV=1
10	Q8IZJ1	0.0	1952	945	1.000	1.000	UNC5B_HUMAN Netrin receptor UNC5B OS=Homo sapiens OX=9606 GN=UNC5B PE=1 SV=2
11	Q8K1S2	0.0	1001	956	0.540	0.533	UNC5D_MOUSE Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1
12	Q8K1S3	0.0	1775	945	0.924	0.924	UNC5B_MOUSE Netrin receptor UNC5B OS=Mus musculus OX=10090 GN=Unc5b PE=1 SV=1
13	Q8K1S4	0.0	964	898	0.531	0.559	UNC5A_MOUSE Netrin receptor UNC5A OS=Mus musculus OX=10090 GN=Unc5a PE=1 SV=1
14	Q26261	1.49e-105	352	947	0.279	0.279	UNC5_CAEEL Netrin receptor unc-5 OS=Caenorhabditis elegans OX=6239 GN=unc-5 PE=1 SV=3
15	Q95TU8	3.42e-63	234	1072	0.135	0.119	UNC5_DROME Netrin receptor unc-5 OS=Drosophila melanogaster OX=7227 GN=unc-5 PE=1 SV=1
16	D3YXG0	3.55e-33	142	5634	0.089	0.015	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
17	Q96RW7	1.15e-28	127	5635	0.074	0.012	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
18	D4A2G6	1.67e-22	106	1172	0.059	0.048	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
19	Q03350	5.12e-22	105	1172	0.059	0.048	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
20	Q6R653	4.85e-21	100	518	0.105	0.191	UN5CL_MOUSE UNC5C-like protein OS=Mus musculus OX=10090 GN=Unc5cl PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	2.7e-10	51.6	Death domain
2	PF07679 I-set	1.4e-09	49.2	Immunoglobulin I-set domain
3	PF00047 ig	0.0023	29.4	Immunoglobulin domain
4	PF13895 Ig_2	0.0045	28.6	Immunoglobulin domain
5	PF13927 Ig_3	3.2e-08	45.3	Immunoglobulin domain
6	PF19030 TSP1_ADAMTS	3.6	19.2	Thrombospondin type 1 domain
7	PF19035 TSP1_CCN	65	15.3	CCN3 Nov like TSP1 domain
8	PF19028 TSP1_spondin	5.5e-09	47.5	Spondin-like TSP1 domain
9	PF00090 TSP_1	9.1e-07	40.3	Thrombospondin type 1 domain
10	PF17217 UPA	1.8e-67	236.8	UPA domain
11	PF07686 V-set	1.4e+02	14.1	Immunoglobulin V-set domain
12	PF00791 ZU5	5.1e-29	111.7	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334329

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.999	Netrin-1
2	9606.ENSP00000341198	0.991	Neogenin
3	9606.ENSP00000389140	0.979	Netrin receptor DCC
4	9606.ENSP00000386135	0.976	Death-associated protein kinase 1
5	9606.ENSP00000449241	0.941	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
6	9606.ENSP00000346671	0.939	Tyrosine-protein kinase Fyn
7	9606.ENSP00000311032	0.921	Caspase-3
8	9606.ENSP00000263967	0.901	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
9	9606.ENSP00000428056	0.900	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000246841	0.872	Leucine-rich repeat transmembrane protein FLRT1
11	9606.ENSP00000341189	0.868	Focal adhesion kinase 1
12	9606.ENSP00000362680	0.866	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000367292	0.861	Leucine-rich repeat transmembrane protein FLRT3
14	9606.ENSP00000340998	0.847	Netrin-4
15	9606.ENSP00000340944	0.815	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000311344	0.788	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
17	9606.ENSP00000288266	0.714	DCC-interacting protein 13-alpha
18	9606.ENSP00000261891	0.711	Death-associated protein kinase 2
19	9606.ENSP00000442973	0.703	Death-associated protein kinase 3
20	9606.ENSP00000330237	0.682	Caspase-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060089	0.884	molecular transducer activity
GO:0038023	0.870	signaling receptor activity
GO:0004888	0.847	transmembrane signaling receptor activity
GO:0005042	0.424	netrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0032502	0.975	developmental process
GO:0048856	0.973	anatomical structure development
GO:0010941	0.971	regulation of cell death
GO:0023051	0.970	regulation of signaling
GO:0032501	0.968	multicellular organismal process
GO:0048518	0.967	positive regulation of biological process
GO:0009987	0.964	cellular process
GO:0050896	0.954	response to stimulus
GO:0048583	0.952	regulation of response to stimulus
GO:0048522	0.950	positive regulation of cellular process
GO:0007275	0.949	multicellular organism development
GO:2001233	0.926	regulation of apoptotic signaling pathway
GO:0048731	0.918	system development
GO:0009653	0.880	anatomical structure morphogenesis
GO:0023056	0.853	positive regulation of signaling
GO:0010647	0.853	positive regulation of cell communication
GO:0097485	0.848	neuron projection guidance
GO:2001236	0.822	regulation of extrinsic apoptotic signaling pathway
GO:0048584	0.792	positive regulation of response to stimulus
GO:0007411	0.790	axon guidance
GO:0048519	0.785	negative regulation of biological process
GO:0009967	0.781	positive regulation of signal transduction
GO:0010942	0.663	positive regulation of cell death
GO:0051716	0.552	cellular response to stimulus
GO:0048523	0.552	negative regulation of cellular process
GO:0007165	0.532	signal transduction
GO:0043065	0.504	positive regulation of apoptotic process
GO:1902531	0.472	regulation of intracellular signal transduction
GO:2001239	0.351	regulation of extrinsic apoptotic signaling pathway in absence of ligand

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.943	intracellular anatomical structure
GO:0005737	0.870	cytoplasm
GO:0005829	0.824	cytosol
GO:0043227	0.688	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]