StarFunc result for job id Q8IZL2

User Input

>input (1156 residues)
MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYER
GRAESSDRERESTLQLLSLVQHGQGARKAGKHTKATATAATTTAPPPPPAAPPAASQAAA
TAAPPPPPDYHHHHQQHLLNSSNNGGSGGINGEQQPPASTPGDQRNSALIALQGSLKRKQ
VVNLSPANSKRPNGFVDNSFLDIKRIRVGENLSAGQGGLQINNGQSQIMSGTLPMSQAPL
RKTNTLPSHTHSPGNGLFNMGLKEVKKEPGETLSCSKHMDGQMTQENIFPNRYGDDPGEQ
LMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQRSTPRPSLPME
KIVIKSEYSPGLTQGPSGSPQLRPPSAGPAFSMANSALSTSSPIPSVPQSQAQPQTGSGA
SRALPSWQEVSHAQQLKQIAANRQQHARMQQHQQQHQPTNWSALPSSAGPSPGPFGQEKI
PSPSFGQQTFSPQSSPMPGVAGGSGQSKVMANYMYKAGPSAQGGHLDVLMQQKPQDLSRS
FINNPHPAMEPRQGNTKPLFHFNSDQANQQMPSVLPSQNKPSLLHYTQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQSSISAQQQQQQQSSISAQQQQQQQQQQQQQQQQQQQQQQ
QQQQQPSSQPAQSLPSQPLLRSPLPLQQKLLLQQMQNQPIAGMGYQVSQQQRQDQHSVVG
QNTGPSPSPNPCSNPNTGSGYMNSQQSLLNQQLMGKKQTLQRQIMEQKQQLLLQQQMLAD
AEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHT
ILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQRNPKQLL
ANQNNPMMPRPPTLGPSNNNNVATFGAGSVGNSQQLRPNLTHSMASMPPQRTSNVMITSN
TTAPNWASQEGTSKQQEALTSAGVRFPTGTPAAYTPNQSLQQAVGSQQFSQRAVAPPNQL
TPAVQMRPMNQMSQTLNGQTMGPLRGLNLRPNQLSTQILPNLNQSGTGLNQSRTGINQPP
SLTPSNFPSPNQSSRAFQGTDHSSDLAFDFLSQQNDNMGPALNSDADFIDSLLKTEPGND
DWMKDINLDEILGNNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZL2	1.000	1.000	0.000	1156	1.000	1.000	Q8IZL2.pdb.gz	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
2	AFDB:Q6T264	0.075	0.083	3.962E-20	1020	0.250	0.283	Q6T264.pdb.gz	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
3	AFDB:Q92585	0.098	0.108	2.318E-17	1016	0.242	0.276	Q92585.pdb.gz	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
4	AFDB:Q24079	0.048	0.046	3.731E-4	1221	0.130	0.123	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
5	AFDB:Q9NWH9	0.041	0.046	1.028E-3	1034	0.110	0.123	Q9NWH9.pdb.gz	SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2
6	AFDB:P21519	0.053	0.046	1.188E-3	1594	0.196	0.142	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
7	AFDB:Q13495	0.046	0.066	2.833E-3	774	0.139	0.208	Q13495.pdb.gz	MAMD1_HUMAN Mastermind-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAMLD1 PE=1 SV=2
8	AFDB:Q69ZZ9	0.059	0.066	3.274E-3	979	0.116	0.137	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
9	AFDB:P20482	0.032	0.028	6.754E-3	1383	0.137	0.114	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
10	AFDB:Q7KNQ9	0.035	0.028	9.023E-3	1557	0.148	0.110	Q7KNQ9.pdb.gz	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZL2	0.0	2290	1156	1.000	1.000	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
2	Q6T264	1.89e-15	84.3	1020	0.124	0.140	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
3	Q96JK9	4.49e-14	79.7	1138	0.092	0.093	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
4	Q92585	4.47e-09	63.5	1016	0.026	0.030	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
5	Q13495	1.95e-06	54.7	774	0.054	0.081	MAMD1_HUMAN Mastermind-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAMLD1 PE=1 SV=2
6	Q8IDX6	2.93e-06	54.3	3130	0.018	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
7	B2ZX90	0.009	42.7	940	0.016	0.019	FAS1_ORYSJ Chromatin assembly factor 1 subunit FSM OS=Oryza sativa subsp. japonica OX=39947 GN=FSM PE=2 SV=1
8	A1Z8M2	0.15	38.9	2999	0.016	0.006	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
9	A8DYA3	0.16	38.9	3131	0.016	0.006	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
10	Q8BRH4	2.4	35.0	4903	0.019	0.004	KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2
11	C0H5F4	4.0	34.3	3254	0.019	0.007	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12722 Hid1	4.3e+02	10.5	High-temperature-induced dauer-formation protein
2	PF09596 MamL-1	1.1e-12	59.3	MamL-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.985	Recombining binding protein suppressor of hairless
2	9606.ENSP00000277541	0.964	Neurogenic locus notch homolog protein 1
3	9606.ENSP00000292599	0.950	Mastermind-like protein 1
4	9606.ENSP00000479618	0.942	Myc proto-oncogene protein
5	9606.ENSP00000263253	0.939	Histone acetyltransferase p300
6	9606.ENSP00000364163	0.938	Neurogenic locus notch homolog protein 4
7	9606.ENSP00000367714	0.930	Transcription factor HES-5
8	9606.ENSP00000263388	0.922	Neurogenic locus notch homolog protein 3
9	9606.ENSP00000364912	0.921	Msx2-interacting protein
10	9606.ENSP00000345001	0.920	CREB-regulated transcription coactivator 1
11	9606.ENSP00000338272	0.917	Hairy/enhancer-of-split related with YRPW motif protein 1
12	9606.ENSP00000357348	0.917	Hairy/enhancer-of-split related with YRPW motif protein 2
13	9606.ENSP00000384018	0.916	Nuclear receptor corepressor 2
14	9606.ENSP00000361943	0.913	Hairy/enhancer-of-split related with YRPW motif-like protein
15	9606.ENSP00000232424	0.909	Transcription factor HES-1
16	9606.ENSP00000405890	0.906	Pre-B-cell leukemia transcription factor 1
17	9606.ENSP00000256646	0.905	Neurogenic locus notch homolog protein 2
18	9606.ENSP00000268712	0.902	Nuclear receptor corepressor 1
19	9606.ENSP00000362649	0.902	Histone deacetylase 1
20	9606.ENSP00000477815	0.902	Pre T-cell antigen receptor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0010468	0.991	regulation of gene expression
GO:0048518	0.990	positive regulation of biological process
GO:0050896	0.986	response to stimulus
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0048522	0.982	positive regulation of cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0007219	0.953	Notch signaling pathway
GO:0006357	0.946	regulation of transcription by RNA polymerase II
GO:0010557	0.925	positive regulation of macromolecule biosynthetic process
GO:0045935	0.925	positive regulation of nucleobase-containing compound metabolic process
GO:0045944	0.919	positive regulation of transcription by RNA polymerase II
GO:0032502	0.308	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.948	protein-containing complex
GO:0005737	0.757	cytoplasm
GO:0005829	0.478	cytosol
GO:0043232	0.427	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]