StarFunc result for job id Q8IZL8

User Input

>input (1130 residues)
MAAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTGSAVAPVHPPN
RSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESP
TELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGL
LTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECY
SRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSS
EDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLSVSSKNISLHG
DGPLRLLLLPSIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWSIGRDSLSPGQ
ERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPRG
SPDGSLQTGKPSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLSRTILMCGPLI
KEETHRRLHDLVLPLVMGVQQGEVLGSSPYTSSRCRRELYCLLLALLLAPSPRCPPPLAC
ALQAFSLGQREDSLEVSSFCSEALVTCAALTHPRVPPLQPMGPTCPTPAPVPPPEAPSPF
RAPPFHPPGPMPSVGSMPSAGPMPSAGPMPSAGPVPSARPGPPTTANHLGLSVPGLVSVP
PRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISL
ESDSDDSVVIVPEGLPPLPPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLP
PPPPPPPPVPGPVTLPPPQLVPEGTPGGGGPPALEEDLTVININSSDEEEEEEEEEEEEE
EEEEEEEEDFEEEEEDEEEYFEEEEEEEEEFEEEFEEEEGELEEEEEEEDEEEEEELEEV
EDLEFGTAGGEVEEGAPPPPTLPPALPPPESPPKVQPEPEPEPGLLLEVEEPGTEEERGA
DTAPTLAPEALPSQGEVEREGESPAAGPPPQELVEEEPSAPPTLLEEETEDGSDKVQPPP
ETPAEEEMETETEAEALQEKEQDDTAAMLADFIDCPPDDEKPPPPTEPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9JFV4	0.519	0.497	0.000	1180	1.000	0.958	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
2	AFDB:Q9DBD5	0.646	0.650	2.995E-99	1123	0.867	0.873	Q9DBD5.pdb.gz	PELP1_MOUSE Proline-, glutamic acid- and leucine-rich protein 1 OS=Mus musculus OX=10090 GN=Pelp1 PE=1 SV=2
3	PDB:6yleC	0.357	0.683	1.250E-6	545	0.082	0.171	6yleC.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
4	AFDB:Q6PR54	0.121	0.063	2.044E-6	2419	0.121	0.057	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
5	PDB:6ylh7	0.347	0.660	3.155E-6	547	0.082	0.170	6ylh7.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
6	AFDB:Q9VW47	0.112	0.072	9.937E-6	2531	0.128	0.057	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
7	AFDB:Q5UIP0	0.123	0.064	1.116E-5	2472	0.144	0.066	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
8	AFDB:E1C2U2	0.112	0.065	1.705E-5	2326	0.143	0.070	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
9	AFDB:Q9Y4F4	0.118	0.086	3.833E-5	1720	0.145	0.095	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
10	AFDB:Q6A070	0.114	0.085	4.303E-5	1776	0.153	0.097	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
11	PDB:1wa5B	0.188	0.370	1.676E-4	466	0.056	0.135	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	PDB:7unkA	0.270	0.287	2.033E-4	1047	0.091	0.098	7unkA.pdb.gz
13	AFDB:Q1LVF3	0.113	0.110	2.092E-4	1180	0.123	0.118	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
14	PDB:4tnmA	0.198	0.412	2.372E-4	407	0.052	0.145	4tnmA.pdb.gz
15	AFDB:B3DI22	0.110	0.110	2.441E-4	1130	0.125	0.125	B3DI22.pdb.gz	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
16	PDB:1qgkA	0.248	0.299	4.071E-4	876	0.058	0.074	1qgkA.pdb.gz
17	PDB:7wttK	0.124	0.134	4.231E-4	1022	0.081	0.090	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:6xu2A	0.204	0.210	4.937E-4	1091	0.069	0.071	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:6ez8A	0.240	0.132	6.467E-4	2353	0.083	0.040	6ez8A.pdb.gz
20	PDB:6ahd1	0.188	0.198	8.151E-4	1048	0.071	0.076	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JFV4	0.0	2175	1180	1.000	0.958	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
2	E7EV54	0.0	1233	906	0.654	0.816	E7EV54_HUMAN Proline, glutamate and leucine rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=1
3	Q8IZL8	0.0	2173	1130	1.000	1.000	PELP1_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
4	Q9DBD5	0.0	1261	1123	0.686	0.690	PELP1_MOUSE Proline-, glutamic acid- and leucine-rich protein 1 OS=Mus musculus OX=10090 GN=Pelp1 PE=1 SV=2
5	Q12019	3.42e-05	50.8	4910	0.058	0.013	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
6	Q8IHN4	5.68e-04	47.0	6093	0.031	0.006	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2
7	Q8SX83	0.005	43.9	5560	0.022	0.004	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
8	Q54CF8	3.7	34.3	3071	0.018	0.007	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08166 NUC202	1.9e-43	157.7	NUC202 domain
2	PF08167 RIX1	7.9e-22	89.5	rRNA processing/ribosome biogenesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301396

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314029	0.999	Sentrin-specific protease 3
2	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000363822	0.999	Androgen receptor
4	9606.ENSP00000363944	0.999	Ribosomal biogenesis protein LAS1L
5	9606.ENSP00000364037	0.999	Testis-expressed protein 10
6	9606.ENSP00000405330	0.999	Estrogen receptor
7	9606.ENSP00000476117	0.992	WD repeat-containing protein 18
8	9606.ENSP00000263253	0.967	Histone acetyltransferase p300
9	9606.ENSP00000366934	0.965	Polynucleotide 5'-hydroxyl-kinase NOL9
10	9606.ENSP00000401303	0.954	SHC-transforming protein 1
11	9606.ENSP00000351446	0.945	WD repeat-containing protein 5
12	9606.ENSP00000262367	0.942	CREB-binding protein
13	9606.ENSP00000325690	0.940	Histone-arginine methyltransferase CARM1
14	9606.ENSP00000451828	0.938	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000302665	0.935	Insulin-like growth factor I
16	9606.ENSP00000428056	0.934	Phosphatidylinositol 3-kinase regulatory subunit alpha
17	9606.ENSP00000391669	0.932	Breast cancer anti-estrogen resistance protein 1
18	9606.ENSP00000318297	0.929	RuvB-like 1
19	9606.ENSP00000268035	0.927	Insulin-like growth factor 1 receptor
20	9606.ENSP00000346120	0.916	Nucleolar RNA helicase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.645	nucleic acid binding
GO:0019899	0.422	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0010604	0.996	positive regulation of macromolecule metabolic process
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0048522	0.995	positive regulation of cellular process
GO:0051173	0.994	positive regulation of nitrogen compound metabolic process
GO:0031325	0.994	positive regulation of cellular metabolic process
GO:0070887	0.985	cellular response to chemical stimulus
GO:0043627	0.982	response to estrogen
GO:0071310	0.982	cellular response to organic substance
GO:0071495	0.981	cellular response to endogenous stimulus
GO:0045893	0.980	positive regulation of DNA-templated transcription
GO:0032870	0.947	cellular response to hormone stimulus
GO:0071391	0.930	cellular response to estrogen stimulus
GO:0006357	0.928	regulation of transcription by RNA polymerase II
GO:0045944	0.831	positive regulation of transcription by RNA polymerase II
GO:0008152	0.520	metabolic process
GO:0071704	0.461	organic substance metabolic process
GO:0044238	0.399	primary metabolic process
GO:0006807	0.391	nitrogen compound metabolic process
GO:0044237	0.323	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0032991	0.988	protein-containing complex
GO:1990234	0.959	transferase complex
GO:0140513	0.958	nuclear protein-containing complex
GO:0034708	0.935	methyltransferase complex
GO:0035097	0.928	histone methyltransferase complex
GO:0044665	0.924	MLL1/2 complex
GO:0071339	0.912	MLL1 complex
GO:0000785	0.864	chromatin
GO:0016020	0.627	membrane
GO:0005737	0.496	cytoplasm
GO:0005829	0.324	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]