StarFunc result for job id Q8IZP0

User Input

>input (508 residues)
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPPPSGAPPAPPLAPLLPVSTVI
AAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSI
SIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKND
DGWYEGVCNRVTGLFPGNYVESIMHYTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZP0	1.000	1.000	7.211E-75	508	1.000	1.000	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
2	AFDB:Q8CBW3	0.516	0.541	5.078E-69	481	0.931	0.983	Q8CBW3.pdb.gz	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
3	AFDB:Q66IV2	0.401	0.404	1.882E-65	503	0.886	0.895	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
4	AFDB:F8WAL6	0.274	0.259	2.499E-52	542	0.728	0.683	F8WAL6.pdb.gz	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
5	AFDB:P62484	0.476	0.535	1.665E-51	446	0.661	0.753	P62484.pdb.gz	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
6	AFDB:Q9NYB9	0.480	0.476	3.337E-51	513	0.659	0.653	Q9NYB9.pdb.gz	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
7	AFDB:E7EW77	0.306	0.321	2.032E-49	480	0.671	0.710	E7EW77.pdb.gz	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
8	AFDB:E9PEZ7	0.324	0.352	6.460E-45	458	0.589	0.653	E9PEZ7.pdb.gz	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
9	AFDB:A0A0B4K774	0.384	0.405	3.873E-33	477	0.402	0.428	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
10	AFDB:Q9P2A4	0.332	0.445	3.705E-29	366	0.366	0.508	Q9P2A4.pdb.gz	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
11	PDB:4n78F	0.282	0.849	9.073E-21	156	0.274	0.891	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:3qwyA	0.114	0.332	1.006E-5	170	0.037	0.112	3qwyA.pdb.gz
13	PDB:1griA	0.112	0.264	1.071E-5	211	0.041	0.100	1griA.pdb.gz
14	PDB:2dybA	0.108	0.182	1.668E-5	298	0.031	0.054	2dybA.pdb.gz
15	PDB:3ehqA	0.112	0.303	1.668E-5	182	0.043	0.121	3ehqA.pdb.gz
16	PDB:1k9aB	0.103	0.118	8.100E-5	441	0.026	0.029	1k9aB.pdb.gz
17	PDB:1k0xA	0.111	0.503	1.963E-4	108	0.030	0.139	1k0xA.pdb.gz
18	PDB:2h8hA	0.099	0.113	1.963E-4	445	0.031	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:2lqnA	0.107	0.176	4.191E-4	303	0.041	0.069	2lqnA.pdb.gz
20	PDB:6x5hA	0.103	0.112	7.886E-4	467	0.035	0.039	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8WAL6	0.0	578	542	0.717	0.672	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
2	Q66IV2	0.0	780	503	0.878	0.887	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
3	Q8CBW3	0.0	954	481	0.931	0.983	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
4	Q8IZP0	0.0	1029	508	1.000	1.000	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
5	Q9QZM5	0.0	937	476	0.925	0.987	ABI1_RAT Abl interactor 1 OS=Rattus norvegicus OX=10116 GN=Abi1 PE=1 SV=3
6	E7EP65	5.46e-138	409	486	0.502	0.525	E7EP65_HUMAN Abl interactor 2 (Fragment) OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
7	E7EW77	2.50e-137	407	480	0.488	0.517	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
8	Q9NYB9	8.87e-137	407	513	0.498	0.493	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
9	A0A0C4DG21	3.47e-133	397	507	0.498	0.499	A0A0C4DG21_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
10	P62484	1.05e-129	386	446	0.474	0.540	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
11	E9PEZ7	1.29e-92	291	458	0.272	0.301	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
12	Q9P2A4	1.38e-57	197	366	0.213	0.295	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
13	A0A0B4K774	8.37e-54	190	477	0.197	0.210	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
14	A0A0B4KH51	9.65e-54	190	472	0.197	0.212	A0A0B4KH51_DROME Abelson interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
15	Q9Y0S9	9.86e-54	190	473	0.197	0.211	Q9Y0S9_DROME Abelson interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
16	Q8BYZ1	9.53e-52	182	367	0.197	0.272	ABI3_MOUSE ABI gene family member 3 OS=Mus musculus OX=10090 GN=Abi3 PE=1 SV=3
17	Q10929	1.37e-44	165	469	0.191	0.207	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
18	F8W7U0	5.71e-10	64.3	1149	0.051	0.023	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
19	Q9P7E8	6.01e-10	64.3	857	0.055	0.033	APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=app1 PE=2 SV=1
20	Q9Z0R6	8.65e-10	63.9	1659	0.049	0.015	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07815 Abi_HHR	7.7e-33	123.8	Abl-interactor HHR
2	PF16886 ATP-synt_ab_Xtn	2.7e+02	12.8	ATPsynthase alpha/beta subunit N-term extension
3	PF16677 GP3_package	7.6e+02	11.5	DNA-packaging protein gp3
4	PF00018 SH3_1	1.8e-13	61.2	SH3 domain
5	PF07653 SH3_2	5.1e-07	40.7	Variant SH3 domain
6	PF14604 SH3_9	1.2e-10	52.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010379741.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010355490.1	0.999	Nck-associated protein 1
2	61622.XP_010367686.1	0.998	BRICK1, SCAR/WAVE actin nucleating complex subunit
3	61622.XP_010361715.1	0.997	Belongs to the CYFIP family.
4	61622.XP_010372155.1	0.997	Nck-associated protein 1-like
5	61622.XP_010360477.1	0.996	Belongs to the CYFIP family.
6	61622.XP_010378678.1	0.996	wiskott-Aldrich syndrome protein family member 2
7	61622.XP_010364318.1	0.995	WAS protein family member 1
8	61622.XP_010366777.1	0.992	Epidermal growth factor receptor pathway substrate 8
9	61622.XP_010359254.1	0.982	Tyrosine-protein kinase ABL1 isoform X1
10	61622.XP_010362443.1	0.977	SOS Ras/Rac guanine nucleotide exchange factor 1
11	61622.XP_010352566.1	0.966	BAI1 associated protein 2
12	61622.XP_010350921.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 443 ESTs, 3 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
13	61622.XP_010366290.1	0.960	Neural Wiskott-Aldrich syndrome protein
14	61622.XP_010373392.1	0.958	WAS protein family member 3
15	61622.XP_010359397.1	0.943	Wiskott-Aldrich syndrome
16	61622.XP_010358515.1	0.940	Actin-related protein 2/3 complex subunit 2
17	61622.XP_010366046.1	0.934	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
18	61622.XP_010373985.1	0.916	ABL proto-oncogene 2, non-receptor tyrosine kinase
19	61622.XP_010377526.1	0.912	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
20	61622.XP_010367249.1	0.896	Actin-related protein 2/3 complex subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035591	0.980	signaling adaptor activity
GO:0019904	0.977	protein domain specific binding
GO:0017124	0.955	SH3 domain binding
GO:0050839	0.743	cell adhesion molecule binding
GO:0045296	0.728	cadherin binding
GO:0019899	0.717	enzyme binding
GO:0008092	0.583	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048518	0.955	positive regulation of biological process
GO:0032501	0.950	multicellular organismal process
GO:0032502	0.949	developmental process
GO:0048856	0.942	anatomical structure development
GO:0051716	0.887	cellular response to stimulus
GO:0007165	0.877	signal transduction
GO:0042325	0.839	regulation of phosphorylation
GO:0048522	0.831	positive regulation of cellular process
GO:0071840	0.818	cellular component organization or biogenesis
GO:0060255	0.818	regulation of macromolecule metabolic process
GO:0050790	0.804	regulation of catalytic activity
GO:0001932	0.802	regulation of protein phosphorylation
GO:0016043	0.787	cellular component organization
GO:0007275	0.750	multicellular organism development
GO:0051338	0.724	regulation of transferase activity
GO:0045859	0.669	regulation of protein kinase activity
GO:0048731	0.620	system development
GO:0009653	0.598	anatomical structure morphogenesis
GO:0048869	0.592	cellular developmental process
GO:0009893	0.561	positive regulation of metabolic process
GO:0048519	0.484	negative regulation of biological process
GO:0010604	0.484	positive regulation of macromolecule metabolic process
GO:0051173	0.480	positive regulation of nitrogen compound metabolic process
GO:0031325	0.475	positive regulation of cellular metabolic process
GO:0048523	0.464	negative regulation of cellular process
GO:0044093	0.460	positive regulation of molecular function
GO:0043085	0.454	positive regulation of catalytic activity
GO:0051128	0.442	regulation of cellular component organization
GO:0030154	0.413	cell differentiation
GO:0007423	0.395	sensory organ development
GO:0051247	0.371	positive regulation of protein metabolic process
GO:0007166	0.364	cell surface receptor signaling pathway
GO:0042327	0.333	positive regulation of phosphorylation
GO:0006996	0.319	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.998	organelle
GO:0032991	0.997	protein-containing complex
GO:0120025	0.994	plasma membrane bounded cell projection
GO:0005829	0.986	cytosol
GO:0031252	0.976	cell leading edge
GO:0043227	0.969	membrane-bounded organelle
GO:0016020	0.967	membrane
GO:0043229	0.966	intracellular organelle
GO:0031209	0.961	SCAR complex
GO:0005576	0.929	extracellular region
GO:0030027	0.915	lamellipodium
GO:0071944	0.913	cell periphery
GO:0043231	0.892	intracellular membrane-bounded organelle
GO:0030054	0.874	cell junction
GO:0043230	0.842	extracellular organelle
GO:0005886	0.838	plasma membrane
GO:0005615	0.827	extracellular space
GO:0031982	0.816	vesicle
GO:1903561	0.794	extracellular vesicle
GO:0043228	0.777	non-membrane-bounded organelle
GO:0070062	0.768	extracellular exosome
GO:0043232	0.749	intracellular non-membrane-bounded organelle
GO:0005634	0.700	nucleus
GO:0005856	0.655	cytoskeleton
GO:0012505	0.629	endomembrane system
GO:0070161	0.575	anchoring junction
GO:0070013	0.538	intracellular organelle lumen
GO:0015629	0.520	actin cytoskeleton
GO:0031981	0.452	nuclear lumen
GO:0005654	0.435	nucleoplasm
GO:0045202	0.412	synapse
GO:0043005	0.312	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]