StarFunc result for job id Q8IZP2

User Input

>input (240 residues)
MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGTATQKAKSEENTKEEKPDSK
VEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEA
LNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQP
YKRRGKAHRLLGHWEEAAHDLALACKFDYDEDASAMLKEVQPRAQKIAEHQRKYERKREE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZP2	1.000	1.000	1.296E-31	240	1.000	1.000	Q8IZP2.pdb.gz	ST134_HUMAN Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1
2	AFDB:Q99L47	0.755	0.504	9.418E-27	371	0.883	0.571	Q99L47.pdb.gz	F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus OX=10090 GN=St13 PE=1 SV=1
3	AFDB:Q8VWG7	0.686	0.440	9.409E-19	380	0.479	0.303	Q8VWG7.pdb.gz	TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana OX=3702 GN=TDX PE=1 SV=1
4	AFDB:Q93YR3	0.663	0.369	1.600E-17	441	0.475	0.259	Q93YR3.pdb.gz	F10AL_ARATH FAM10 family protein At4g22670 OS=Arabidopsis thaliana OX=3702 GN=At4g22670 PE=1 SV=1
5	AFDB:C4NYP8	0.681	0.439	2.691E-17	377	0.417	0.265	C4NYP8.pdb.gz	F10A1_DROME Hsc70-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=HIP PE=1 SV=2
6	AFDB:G5EE04	0.685	0.401	2.854E-16	422	0.450	0.256	G5EE04.pdb.gz	G5EE04_CAEEL STI1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hip-1 PE=1 SV=1
7	AFDB:Q8I3J0	0.663	0.368	2.226E-13	458	0.358	0.188	Q8I3J0.pdb.gz	Q8I3J0_PLAF7 Hsc70-interacting protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0527500 PE=4 SV=1
8	AFDB:Q9VJD4	0.476	0.347	3.024E-7	331	0.175	0.127	Q9VJD4.pdb.gz	Q9VJD4_DROME LD24721p OS=Drosophila melanogaster OX=7227 GN=Sgt PE=1 SV=1
9	AFDB:Q9M0B2	0.496	0.436	3.324E-7	277	0.188	0.162	Q9M0B2.pdb.gz	Q9M0B2_ARATH AT4G30480 protein OS=Arabidopsis thaliana OX=3702 GN=TPR1 PE=1 SV=1
10	AFDB:Q9MUK5	0.488	0.200	4.626E-7	593	0.146	0.059	Q9MUK5.pdb.gz	TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum OX=3888 GN=TOC64 PE=1 SV=1
11	PDB:7obeA	0.473	0.247	1.971E-6	480	0.179	0.090	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
12	PDB:7kw7E	0.471	0.348	1.030E-5	327	0.133	0.098	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:7dhgC	0.452	0.236	1.502E-5	470	0.146	0.074	7dhgC.pdb.gz
14	PDB:2c2lA	0.469	0.403	1.651E-5	281	0.121	0.103	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
15	PDB:1ihgA	0.477	0.322	8.226E-5	364	0.125	0.082	1ihgA.pdb.gz
16	PDB:5njxA	0.474	0.282	9.478E-5	413	0.117	0.068	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
17	PDB:4nrhB	0.429	0.586	1.520E-4	170	0.083	0.118	4nrhB.pdb.gz
18	PDB:1wao1	0.469	0.245	1.671E-4	471	0.138	0.070	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
19	PDB:2y4uA	0.418	0.248	2.018E-4	424	0.117	0.066	2y4uA.pdb.gz
20	PDB:7ntfA	0.437	0.118	2.325E-4	918	0.125	0.033	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZP2	4.55e-178	490	240	1.000	1.000	ST134_HUMAN Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1
2	A0A140VKA6	3.43e-166	465	369	0.967	0.629	A0A140VKA6_HUMAN Testis secretory sperm-binding protein Li 233m OS=Homo sapiens OX=9606 PE=2 SV=1
3	P50502	3.43e-166	465	369	0.967	0.629	F10A1_HUMAN Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2
4	Q99L47	1.49e-148	420	371	0.858	0.555	F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus OX=10090 GN=St13 PE=1 SV=1
5	P50503	2.11e-145	412	368	0.842	0.549	F10A1_RAT Hsc70-interacting protein OS=Rattus norvegicus OX=10116 GN=St13 PE=1 SV=1
6	Q3KNR6	6.50e-141	395	211	0.825	0.938	Q3KNR6_HUMAN ST13 protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=1
7	F6VDH7	8.29e-105	301	162	0.646	0.957	F6VDH7_HUMAN ST13 Hsp70 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=1
8	Q8VWG7	1.11e-67	215	380	0.483	0.305	TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana OX=3702 GN=TDX PE=1 SV=1
9	Q93YR3	2.97e-67	216	441	0.492	0.268	F10AL_ARATH FAM10 family protein At4g22670 OS=Arabidopsis thaliana OX=3702 GN=At4g22670 PE=1 SV=1
10	G5EE04	1.57e-59	195	422	0.450	0.256	G5EE04_CAEEL STI1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hip-1 PE=1 SV=1
11	C4NYP8	5.28e-56	185	377	0.429	0.273	F10A1_DROME Hsc70-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=HIP PE=1 SV=2
12	Q8I3J0	1.26e-32	125	458	0.342	0.179	Q8I3J0_PLAF7 Hsc70-interacting protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0527500 PE=4 SV=1
13	Q84XU2	4.68e-12	67.4	538	0.192	0.086	PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1
14	B6GVA2	1.54e-11	64.7	261	0.179	0.165	B6GVA2_SOLLC Tetratricopeptide repeat protein OS=Solanum lycopersicum OX=4081 GN=int106 PE=1 SV=1
15	O94826	1.34e-10	62.8	608	0.167	0.066	TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1
16	Q75Q39	5.00e-10	61.2	610	0.167	0.066	TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus OX=10116 GN=Tomm70 PE=1 SV=1
17	Q9CZW5	5.05e-10	61.2	611	0.150	0.059	TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus OX=10090 GN=Tomm70 PE=1 SV=2
18	Q5XEP2	6.06e-10	60.8	571	0.121	0.051	HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
19	Q9MUK5	1.43e-09	60.1	593	0.188	0.076	TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum OX=3888 GN=TOC64 PE=1 SV=1
20	Q54VG4	1.72e-09	59.3	334	0.138	0.099	SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=sgt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18253 HipN	1.9e-14	64.4	Hsp70-interacting protein N N-terminal domain
2	PF04617 Hox9_act	7.2e+02	12.0	Hox9 activation region
3	PF10200 Ndufs5	22	16.7	NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
4	PF01239 PPTA	41	15.4	Protein prenyltransferase alpha subunit repeat
5	PF00515 TPR_1	1.6e-10	51.5	Tetratricopeptide repeat
6	PF13414 TPR_11	1.9e-05	35.6	TPR repeat
7	PF13424 TPR_12	0.95	21.1	Tetratricopeptide repeat
8	PF13428 TPR_14	0.00014	33.3	Tetratricopeptide repeat
9	PF13432 TPR_16	0.019	26.8	Tetratricopeptide repeat
10	PF13431 TPR_17	0.002	29.5	Tetratricopeptide repeat
11	PF14559 TPR_19	31	16.4	Tetratricopeptide repeat
12	PF07719 TPR_2	4.8e-09	46.7	Tetratricopeptide repeat
13	PF13174 TPR_6	92	15.1	Tetratricopeptide repeat
14	PF13176 TPR_7	19	16.7	Tetratricopeptide repeat
15	PF13181 TPR_8	0.019	26.2	Tetratricopeptide repeat
16	PF13371 TPR_9	1.2e-05	36.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000013232

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017643	0.871	Pongo abelii heat shock 70kDa protein 4 (HSPA4), mRNA
2	9601.ENSPPYP00000004564	0.834	Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chap [...]
3	9601.ENSPPYP00000005659	0.834	Uncharacterized protein
4	9601.ENSPPYP00000024459	0.834	Uncharacterized protein
5	9601.ENSPPYP00000018408	0.827	Heat shock 70 kDa protein 1
6	9601.ENSPPYP00000018406	0.773	Belongs to the heat shock protein 70 family.
7	9601.ENSPPYP00000014577	0.759	Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and asso [...]
8	9601.ENSPPYP00000016819	0.749	Heat shock 70kDa protein 4-like
9	9601.ENSPPYP00000006709	0.719	Belongs to the heat shock protein 70 family.
10	9601.ENSPPYP00000002443	0.705	Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding- competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).
11	9601.ENSPPYP00000003135	0.705	Heat shock 70kDa protein 12A
12	9601.ENSPPYP00000012078	0.705	Heat shock 70kD protein 12B
13	9601.ENSPPYP00000012608	0.705	Heat shock protein 70kDa family, member 13
14	9601.ENSPPYP00000005987	0.689	Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering substrate release. Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities
15	9601.ENSPPYP00000015201	0.672	TRK-fused gene
16	9601.ENSPPYP00000000695	0.664	Heat shock 70kDa protein 6 (HSP70B')
17	9601.ENSPPYP00000021973	0.662	Endoplasmic reticulum chaperone that plays a key role in protein folding and quality control in the endoplasmic reticulum lumen (By similarity). Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10/ERdj5, probably to facilitate the release of DNAJC10/ERdj5 from its substrate (By similarity). Acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR). In the unstressed endoplasmic reticulum, recruited by DNAJB9/ERdj4 to the luminal region of ERN1/IRE1, leading to disrupt the dimerization of ERN1/IRE1, t [...]
18	9601.ENSPPYP00000017699	0.623	Chaperone protein which plays an important role in mitochondrial iron-sulfur cluster (ISC) biogenesis. Interacts with and stabilizes ISC cluster assembly proteins FXN, NFU1, NFS1 and ISCU. Regulates erythropoiesis via stabilization of ISC assembly. May play a role in the control of cell proliferation and cellular aging.
19	9601.ENSPPYP00000024257	0.623	Uncharacterized protein
20	9601.ENSPPYP00000009818	0.622	This multifunctional protein catalyzes the formation, breakage and rearrangement of disulfide bonds. At the cell surface, seems to act as a reductase that cleaves disulfide bonds of proteins attached to the cell. May therefore cause structural modifications of exofacial proteins. Inside the cell, seems to form/rearrange disulfide bonds of nascent proteins. At high concentrations, functions as a chaperone that inhibits aggregation of misfolded proteins. At low concentrations, facilitates aggregation (anti-chaperone activity). May be involved with other chaperones in the structural modif [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.668	catalytic activity
GO:1901363	0.358	heterocyclic compound binding
GO:0097159	0.334	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.905	cellular process
GO:0050896	0.531	response to stimulus
GO:0050789	0.474	regulation of biological process
GO:0050794	0.461	regulation of cellular process
GO:0006457	0.389	protein folding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0005622	0.975	intracellular anatomical structure
GO:0005829	0.970	cytosol
GO:0005576	0.945	extracellular region
GO:0031982	0.886	vesicle
GO:1903561	0.753	extracellular vesicle
GO:0005615	0.743	extracellular space
GO:0070062	0.711	extracellular exosome
GO:0043231	0.693	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]