StarFunc result for job id Q8IZP9

User Input

>input (1017 residues)
MVFSVRQCGHVGRTEEVLLTFKIFLVIICLHVVLVTSLEEDTDNSSLSPPPAKLSVVSFA
PSSNGTPEVETTSLNDVTLSLLPSNETEKTKITIVKTFNASGVKPQRNICNLSSICNDSA
FFRGEIMFQYDKESTVPQNQHITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAE
AQSTLNCTFTIKLNNTMNACAVIAALERVKIRPMEHCCCSVRIPCPSSPEELEKLQCDLQ
DPIVCLADHPRGPPFSSSQSIPVVPRATVLSQVPKATSFAEPPDYSPVTHNVPSPIGEIQ
PLSPQPSAPIASSPAIDMPPQSETISSPMPQTHVSGTPPPVKASFSSPTVSAPANVNTTS
APPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLA
QRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQ
APENSIGTITLPSSLMNNLPAHDMELASRVQFNFFETPALFQDPSLENLSLISYVISSSV
ANLTVRNLTRNVTVTLKHINPSQDELTVRCVFWDLGRNGGRGGWSDNGCSVKDRRLNETI
CTCSHLTSFGVLLDLSRTSVLPAQMMALTFITYIGCGLSSIFLSVTLVTYIAFEKIRRDY
PSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVFLHYFLLVSFTWMGLEAFHMY
LALVKVFNTYIRKYILKFCIVGWGVPAVVVTIILTISPDNYGLGSYGKFPNGSPDDFCWI
NNNAVFYITVVGYFCVIFLLNVSMFIVVLVQLCRIKKKKQLGAQRKTSIQDLRSIAGLTF
LLGITWGFAFFAWGPVNVTFMYLFAIFNTLQGFFIFIFYCVAKENVRKQWRRYLCCGKLR
LAENSDWSKTATNGLKKQTVNQGVSSSSNSLQSSSNSTNSTTLLVNNDCSVHASGNGNAS
TERNGVSFSVQNGDVCLHDFTGKQHMFNEKEDSCNGKGRMALRRTSKRGSLHFIEQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZP9	1.000	1.000	0.000	1017	1.000	1.000	Q8IZP9.pdb.gz	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
2	AFDB:Q6F3F9	0.318	0.282	3.642E-56	1165	0.290	0.253	Q6F3F9.pdb.gz	AGRG6_MOUSE Adhesion G-protein coupled receptor G6 OS=Mus musculus OX=10090 GN=Adgrg6 PE=1 SV=1
3	AFDB:Q8IZF4	0.288	0.519	1.333E-32	528	0.140	0.269	Q8IZF4.pdb.gz	AGRG5_HUMAN Adhesion G-protein coupled receptor G5 OS=Homo sapiens OX=9606 GN=ADGRG5 PE=1 SV=3
4	AFDB:Q86Y34	0.266	0.451	6.841E-32	549	0.160	0.297	Q86Y34.pdb.gz	AGRG3_HUMAN Adhesion G protein-coupled receptor G3 OS=Homo sapiens OX=9606 GN=ADGRG3 PE=1 SV=1
5	AFDB:Q8R0T6	0.247	0.439	2.812E-30	542	0.142	0.266	Q8R0T6.pdb.gz	AGRG3_MOUSE Adhesion G protein-coupled receptor G3 OS=Mus musculus OX=10090 GN=Adgrg3 PE=2 SV=3
6	AFDB:F1R8J2	0.351	0.194	5.388E-26	2014	0.155	0.078	F1R8J2.pdb.gz
7	PDB:7lciR	0.211	0.501	7.784E-9	393	0.060	0.155	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
8	PDB:7d3sR	0.224	0.787	9.031E-9	266	0.058	0.222	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
9	PDB:7durR	0.211	0.537	9.031E-9	371	0.061	0.167	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
10	PDB:4k5yC	0.202	0.728	1.278E-8	248	0.063	0.258	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
11	AFDB:Q2EG98	0.151	0.078	1.382E-8	2201	0.096	0.045	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
12	PDB:7tynR	0.215	0.546	2.966E-8	373	0.048	0.131	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
13	PDB:7vqxR	0.224	0.583	6.887E-8	361	0.056	0.158	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
14	PDB:7cz5R	0.211	0.716	9.271E-8	269	0.046	0.175	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
15	PDB:6wpwR	0.216	0.522	1.248E-7	398	0.054	0.138	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
16	PDB:7w55R	0.215	0.635	2.262E-7	303	0.038	0.129	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
17	PDB:7wq3R	0.221	0.676	2.262E-7	289	0.051	0.180	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
18	AFDB:P23385	0.182	0.157	9.859E-3	1199	0.055	0.047	P23385.pdb.gz	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
19	AFDB:Q6PCP7	0.173	0.209	9.859E-3	798	0.054	0.069	Q6PCP7.pdb.gz	GP156_MOUSE Probable G-protein coupled receptor 156 OS=Mus musculus OX=10090 GN=Gpr156 PE=2 SV=2
20	AFDB:Q17R60	0.071	0.087	1.395E-2	797	0.074	0.094	Q17R60.pdb.gz	IMPG1_HUMAN Interphotoreceptor matrix proteoglycan 1 OS=Homo sapiens OX=9606 GN=IMPG1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6KFA3	0.0	578	1185	0.274	0.235	AGRG6_DANRE Adhesion G-protein coupled receptor G6 OS=Danio rerio OX=7955 GN=adgrg6 PE=1 SV=1
2	Q8CJ11	0.0	1614	1013	0.805	0.808	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
3	Q8IZP9	0.0	2088	1017	1.000	1.000	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
4	Q86SQ4	2.40e-163	514	1221	0.254	0.211	AGRG6_HUMAN Adhesion G-protein coupled receptor G6 OS=Homo sapiens OX=9606 GN=ADGRG6 PE=1 SV=3
5	Q6F3F9	7.74e-161	506	1165	0.260	0.227	AGRG6_MOUSE Adhesion G-protein coupled receptor G6 OS=Mus musculus OX=10090 GN=Adgrg6 PE=1 SV=1
6	Q8IZF6	7.76e-157	516	3080	0.246	0.081	AGRG4_HUMAN Adhesion G-protein coupled receptor G4 OS=Homo sapiens OX=9606 GN=ADGRG4 PE=1 SV=2
7	Q86Y34	1.12e-62	224	549	0.142	0.262	AGRG3_HUMAN Adhesion G protein-coupled receptor G3 OS=Homo sapiens OX=9606 GN=ADGRG3 PE=1 SV=1
8	Q9Y653	5.26e-57	212	693	0.137	0.201	AGRG1_HUMAN Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1 PE=1 SV=2
9	Q8K209	4.77e-56	209	687	0.142	0.210	AGRG1_MOUSE Adhesion G-protein coupled receptor G1 OS=Mus musculus OX=10090 GN=Adgrg1 PE=1 SV=1
10	Q8R0T6	2.47e-55	203	542	0.134	0.251	AGRG3_MOUSE Adhesion G protein-coupled receptor G3 OS=Mus musculus OX=10090 GN=Adgrg3 PE=2 SV=3
11	Q8IZF4	4.81e-54	199	528	0.128	0.246	AGRG5_HUMAN Adhesion G-protein coupled receptor G5 OS=Homo sapiens OX=9606 GN=ADGRG5 PE=1 SV=3
12	O95490	2.84e-46	183	1459	0.118	0.082	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
13	Q9UHX3	8.31e-46	180	823	0.179	0.221	AGRE2_HUMAN Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2
14	Q9HAR2	1.20e-45	181	1447	0.136	0.095	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
15	Q9Z173	1.48e-45	181	1550	0.135	0.088	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
16	Q80TS3	1.89e-45	181	1537	0.135	0.089	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
17	Q9BY15	5.65e-44	172	652	0.123	0.192	AGRE3_HUMAN Adhesion G protein-coupled receptor E3 OS=Homo sapiens OX=9606 GN=ADGRE3 PE=2 SV=2
18	Q5Y4N8	1.89e-43	173	932	0.110	0.120	AGRE1_RAT Adhesion G protein-coupled receptor E2 OS=Rattus norvegicus OX=10116 GN=Adgre1 PE=2 SV=1
19	Q8JZZ7	3.20e-43	174	1487	0.117	0.080	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
20	O88923	2.04e-42	171	1487	0.116	0.079	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	2.1e-58	209.1	7 transmembrane receptor (Secretin family)
2	PF01825 GPS	3.9e-10	51.5	GPCR proteolysis site, GPS, motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000409581	0.711	Beta-arrestin-1
2	9606.ENSP00000233055	0.676	WD repeat and FYVE domain-containing protein 1
3	9606.ENSP00000338276	0.650	Cysteine-rich secretory protein 1
4	9606.ENSP00000425961	0.650	Serine peptidase inhibitor, Kazal type 2
5	9606.ENSP00000176195	0.604	Secretin
6	9606.ENSP00000385746	0.579	Spermine synthase
7	9606.ENSP00000287008	0.509	Protocadherin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.958	binding
GO:0005515	0.936	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.998	response to stimulus
GO:0007165	0.992	signal transduction
GO:0032501	0.973	multicellular organismal process
GO:0007186	0.937	G protein-coupled receptor signaling pathway
GO:0032502	0.930	developmental process
GO:0032504	0.808	multicellular organism reproduction
GO:0019953	0.803	sexual reproduction
GO:0022414	0.798	reproductive process
GO:0048232	0.686	male gamete generation
GO:0003006	0.607	developmental process involved in reproduction
GO:0007283	0.592	spermatogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.975	membrane-bounded organelle
GO:0005576	0.971	extracellular region
GO:0031982	0.967	vesicle
GO:0005622	0.955	intracellular anatomical structure
GO:0005615	0.949	extracellular space
GO:0005829	0.949	cytosol
GO:0043230	0.695	extracellular organelle
GO:0070062	0.692	extracellular exosome
GO:0009986	0.677	cell surface
GO:0043229	0.532	intracellular organelle
GO:0043231	0.458	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]