StarFunc result for job id Q8IZQ1

User Input

>input (1400 residues)
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVSELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNVQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVE
DQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMTIQQLVLSP
NGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTLRHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNVADLKLHVTTSSLQ
SSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGL
HARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMITSLEGLGTDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNTVTTGLID
GAVVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLA
IVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIIEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVNTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIAS
LVWRLGPTHFLEEVLPSSNVTTIYELGPNYVGSFQAVCMPCKDAKSEGVVPSPVSLVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGSA
RTIGAALIGYLGVRTFVPKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8MRY5	0.213	0.762	2.173E-21	381	0.128	0.470	Q8MRY5.pdb.gz	Q8MRY5_DROME SD12984p OS=Drosophila melanogaster OX=7227 GN=bchs PE=2 SV=1
2	AFDB:F4I9T0	0.355	0.203	2.999E-15	2604	0.094	0.051	F4I9T0.pdb.gz	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
3	AFDB:E9QCE1	0.216	0.458	1.172E-8	607	0.064	0.148	E9QCE1.pdb.gz
4	AFDB:E1B8W3	0.140	0.179	1.803E-8	1044	0.071	0.096	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
5	AFDB:P18824	0.137	0.197	2.874E-8	843	0.086	0.144	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
6	AFDB:Q54P24	0.161	0.178	3.565E-8	1215	0.066	0.077	Q54P24.pdb.gz	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
7	AFDB:Q5W041	0.133	0.194	4.583E-8	872	0.073	0.117	Q5W041.pdb.gz	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
8	AFDB:Q5T2S8	0.137	0.175	7.574E-8	1044	0.072	0.097	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
9	AFDB:Q9VM21	0.128	0.227	1.394E-7	669	0.070	0.146	Q9VM21.pdb.gz	GUDU_DROME Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
10	AFDB:Q54RQ8	0.204	0.135	2.222E-7	2192	0.051	0.032	Q54RQ8.pdb.gz	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
11	PDB:2z6gA	0.139	0.290	3.525E-7	550	0.053	0.135	2z6gA.pdb.gz
12	PDB:7qenD	0.159	0.191	8.960E-7	1050	0.089	0.119	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
13	PDB:7q2xD	0.147	0.179	1.111E-6	994	0.096	0.135	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
14	PDB:7wttK	0.165	0.209	5.016E-6	1022	0.079	0.108	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:7rroH7	0.123	0.252	5.586E-6	580	0.058	0.140	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7unkA	0.150	0.192	6.001E-6	1047	0.099	0.132	7unkA.pdb.gz
17	PDB:6tc0C	0.151	0.186	8.906E-6	994	0.094	0.133	6tc0C.pdb.gz
18	PDB:6qnxA	0.156	0.218	1.066E-5	928	0.084	0.126	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
19	PDB:7vf2A	0.147	0.163	1.066E-5	1196	0.084	0.098	7vf2A.pdb.gz
20	PDB:7ajuUT	0.125	0.089	1.187E-5	2313	0.094	0.057	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q2M9	0.0	626	3183	0.323	0.142	WDFY4_MOUSE WD repeat- and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Wdfy4 PE=1 SV=2
2	Q6VNB8	0.0	2792	3508	0.959	0.383	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
3	Q6ZS81	0.0	640	3184	0.319	0.140	WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=WDFY4 PE=1 SV=3
4	Q8IZQ1	0.0	2889	3526	1.000	0.397	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
5	Q9VML2	0.0	1157	3489	0.473	0.190	Q9VML2_DROME Blue cheese OS=Drosophila melanogaster OX=7227 GN=bchs PE=4 SV=4
6	Q8MRY5	3.39e-103	335	381	0.129	0.472	Q8MRY5_DROME SD12984p OS=Drosophila melanogaster OX=7227 GN=bchs PE=2 SV=1
7	Q55DM1	1.54e-36	154	3619	0.088	0.034	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
8	F4HZB2	5.11e-13	77.0	3601	0.045	0.017	BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana OX=3702 GN=SPI PE=1 SV=1
9	F4JHT3	3.48e-12	74.3	3527	0.089	0.035	BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana OX=3702 GN=BCHA2 PE=4 SV=1
10	F4I9T0	0.011	42.7	2604	0.031	0.017	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
11	Q19317	0.25	38.5	2507	0.018	0.010	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
12	Q5UMH8	2.8	34.7	433	0.020	0.065	Q5UMH8_CHICK PPTX OS=Gallus gallus OX=9031 PE=1 SV=1
13	O13987	4.0	34.3	1151	0.017	0.021	YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.05 PE=4 SV=1
14	F4I8F9	5.5	33.1	234	0.023	0.137	BH160_ARATH Transcription factor bHLH160 OS=Arabidopsis thaliana OX=3702 GN=BHLH160 PE=3 SV=1
15	Q12514	5.9	33.5	560	0.011	0.029	NOT5_YEAST General negative regulator of transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOT5 PE=1 SV=1
16	Q582G0	6.0	33.9	806	0.024	0.042	Q582G0_TRYB2 Lipin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.580 PE=3 SV=1
17	E7EZD1	6.2	33.9	2998	0.016	0.007	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
18	O94452	8.1	33.1	661	0.019	0.039	MCP1_SCHPO Meiotic coiled-coil protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13764 E3_UbLigase_R4	63	13.1	E3 ubiquitin-protein ligase UBR4
2	PF13385 Laminin_G_3	1	21.0	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306866	0.998	Gamma-aminobutyric acid receptor-associated protein
2	9606.ENSP00000374455	0.997	Sequestosome-1
3	9606.ENSP00000358072	0.984	Autophagy protein 5
4	9606.ENSP00000433623	0.888	TNF receptor-associated factor 6
5	9606.ENSP00000349785	0.881	Microtubule-associated proteins 1A/1B light chain 3C
6	9606.ENSP00000268607	0.879	Microtubule-associated proteins 1A/1B light chain 3B
7	9606.ENSP00000037243	0.866	Gamma-aminobutyric acid receptor-associated protein-like 2
8	9606.ENSP00000266458	0.842	Gamma-aminobutyric acid receptor-associated protein-like 1
9	9606.ENSP00000363970	0.806	Microtubule-associated proteins 1A/1B light chain 3A
10	9606.ENSP00000425107	0.801	Ubiquitin-like protein ATG12
11	9606.ENSP00000411250	0.748	Next to BRCA1 gene 1 protein
12	9606.ENSP00000373696	0.740	E3 ubiquitin-protein ligase TRIP12
13	9606.ENSP00000366475	0.717	Autophagy-related protein 2 homolog A
14	9606.ENSP00000458355	0.717	Dynein heavy chain 2, axonemal
15	9606.ENSP00000378611	0.700	Rho GTPase-activating protein 24
16	9606.ENSP00000347184	0.689	Huntingtin
17	9606.ENSP00000423014	0.686	OCIA domain containing 2
18	9606.ENSP00000346437	0.685	Ubiquitin-like modifier-activating enzyme ATG7
19	9606.ENSP00000471457	0.676	Unconventional myosin-IXb
20	9606.ENSP00000353010	0.673	Autophagy-related protein 2 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005545	0.991	1-phosphatidylinositol binding
GO:0003824	0.455	catalytic activity
GO:0016740	0.381	transferase activity
GO:0008378	0.373	galactosyltransferase activity
GO:0035250	0.360	UDP-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016236	0.975	macroautophagy
GO:0061912	0.838	selective autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0016020	0.986	membrane
GO:0005829	0.958	cytosol
GO:0005634	0.935	nucleus
GO:0031981	0.931	nuclear lumen
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0005886	0.911	plasma membrane
GO:0005654	0.908	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.381	Transferases.
EC:2.4.1.-	0.373	Hexosyltransferases.

[back to server]