StarFunc result for job id Q8IZQ8

User Input

>input (938 residues)
MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPPLKRPAEFHEQRKHLDSDKA
KNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQMKLKRARLADDLNEKIALRPGPLE
LVEKNILPVDSAVKEAIKGNQVSFSKSTDAFAFEEDSSSDGLSPDQTRSEDPQNSAGSPP
DAKASDTPSTGSLGTNQDLASGSENDRNDSASQPSHQSDAGKQGLGPPSTPIAVHAAVKS
KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLLQQQQLFLQLQ
ILSQQQQQQQHRFSYLGMHQAQLKEPNEQMVRNPNSSSTPLSNTPLSPVKNSFSGQTGVS
SFKPGPLPPNLDDLKVSELRQQLRIRGLPVSGTKTALMDRLRPFQDCSGNPVPNFGDITT
VTFPVTPNTLPNYQSSSSTSALSNGFYHFGSTSSSPPISPASSDLSVAGSLPDTFNDASP
SFGLHPSPVHVCTEESLMSSLNGGSVPSELDGLDSEKDKMLVEKQKVINELTWKLQQEQR
QVEELRMQLQKQKRNNCSEKKPLPFLAASIKQEEAVSSCPFASQVPVKRQSSSSECHPPA
CEAAQLQPLGNAHCVESSDQTNVLSSTFLSPQCSPQHSPLGAVKSPQHISLPPSPNNPHF
LPSSSGAQGEGHRVSSPISSQVCTAQMAGLHSSDKVGPKFSIPSPTFSKSSSAISEVTQP
PSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRSSRSPTAVLTK
PSASFEQASSGSQIPFDPYATDSDEHLEVLLNSQSPLGKMSDVTLLKIGSEEPHFDGIMD
GFSGKAAEDLFNAHEILPGPLSPMQTQFSPSSVDSNGLQLSFTESPWETMEWLDLTPPNS
TPGFSALTTSSPSIFNIDFLDVTDLNLNSSMDLHLQQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZQ8	0.999	0.999	0.000	938	1.000	1.000	Q8IZQ8.pdb.gz	MYCD_HUMAN Myocardin OS=Homo sapiens OX=9606 GN=MYOCD PE=1 SV=1
2	AFDB:Q8R5I7	0.206	0.206	1.011E-95	938	0.829	0.829	Q8R5I7.pdb.gz	MYCD_RAT Myocardin OS=Rattus norvegicus OX=10116 GN=Myocd PE=1 SV=2
3	AFDB:Q9ULH7	0.182	0.159	5.757E-39	1088	0.403	0.347	Q9ULH7.pdb.gz	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
4	AFDB:A0A0G2JXC5	0.166	0.151	1.446E-36	1038	0.386	0.349	A0A0G2JXC5.pdb.gz	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
5	AFDB:A0A499FIJ6	0.136	0.124	3.950E-36	1031	0.372	0.339	A0A499FIJ6.pdb.gz	A0A499FIJ6_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
6	AFDB:B7Z043	0.118	0.067	8.575E-14	1788	0.252	0.132	B7Z043.pdb.gz	B7Z043_DROME Myocardin-related transcription factor, isoform H OS=Drosophila melanogaster OX=7227 GN=Mrtf PE=4 SV=3
7	AFDB:Q9W1R4	0.045	0.034	7.888E-3	1395	0.150	0.101	Q9W1R4.pdb.gz	ICE1_DROME Little elongation complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Ice1 PE=1 SV=2
8	AFDB:O43683	0.047	0.044	2.949E-2	1085	0.100	0.087	O43683.pdb.gz	BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1 PE=1 SV=1
9	AFDB:Q28820	0.042	0.052	5.885E-2	706	0.115	0.153	Q28820.pdb.gz	TRDN_RABIT Triadin OS=Oryctolagus cuniculus OX=9986 GN=TRDN PE=1 SV=3
10	AFDB:P82179	0.051	0.063	7.565E-2	701	0.115	0.154	P82179.pdb.gz	TRDN_CANLF Triadin OS=Canis lupus familiaris OX=9615 GN=TRDN PE=1 SV=2
11	PDB:1zbuB	0.036	0.110	1.589	304	0.011	0.033	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
12	PDB:2outA	0.038	0.205	1.802	131	0.018	0.130	2outA.pdb.gz
13	PDB:1kcfA	0.029	0.112	2.627	240	0.011	0.042	1kcfA.pdb.gz
14	PDB:6ah0N	0.026	0.039	3.829	579	0.025	0.040	6ah0N.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	PDB:3fhzD	0.029	0.112	6.328	166	0.006	0.036	3fhzD.pdb.gz	The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
16	PDB:7edxl	0.039	0.174	7.640	107	0.007	0.065	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:5x3tA	0.034	0.242	8.135	70	0.009	0.114	5x3tA.pdb.gz
18	PDB:7mqaNS	0.036	0.037	8.662	914	0.015	0.015	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:1jeqA	0.037	0.063	9.821	548	0.013	0.022	1jeqA.pdb.gz
20	PDB:7ktrH	0.031	0.224	9.821	99	0.006	0.061	7ktrH.pdb.gz	Structure of the human SAGA coactivator complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZQ8	0.0	1900	938	1.000	1.000	MYCD_HUMAN Myocardin OS=Homo sapiens OX=9606 GN=MYOCD PE=1 SV=1
2	Q8R5I7	0.0	1416	938	0.824	0.824	MYCD_RAT Myocardin OS=Rattus norvegicus OX=10116 GN=Myocd PE=1 SV=2
3	Q8VIM5	0.0	1409	935	0.832	0.834	MYCD_MOUSE Myocardin OS=Mus musculus OX=10090 GN=Myocd PE=1 SV=2
4	Q8K4J6	1.22e-117	384	964	0.389	0.379	MRTFA_MOUSE Myocardin-related transcription factor A OS=Mus musculus OX=10090 GN=Mrtfa PE=1 SV=2
5	F1LV40	6.98e-116	380	963	0.393	0.383	F1LV40_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
6	A0A8I5Y2C3	4.20e-115	378	978	0.386	0.370	A0A8I5Y2C3_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
7	A0A0G2K3Y9	7.16e-114	376	1028	0.388	0.354	A0A0G2K3Y9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=4 SV=2
8	A0A0G2JXC5	7.77e-114	376	1038	0.388	0.351	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
9	A0A8I6AI47	1.23e-113	374	992	0.388	0.367	A0A8I6AI47_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
10	Q9ULH7	3.75e-104	351	1088	0.297	0.256	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
11	A0A8I6GFP9	5.22e-98	331	938	0.373	0.373	A0A8I6GFP9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
12	A0A8I5Y4Q9	1.66e-96	328	993	0.371	0.350	A0A8I5Y4Q9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
13	W0Z7M9	2.30e-95	324	966	0.285	0.276	W0Z7M9_HUMAN Mkl1 variant 1 Mkl1_S OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
14	A0A494BZX7	1.36e-94	320	898	0.280	0.293	A0A494BZX7_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
15	B0QY83	2.03e-94	322	981	0.274	0.262	B0QY83_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=3
16	A0A499FIJ6	1.56e-93	320	1031	0.279	0.254	A0A499FIJ6_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
17	F1LVR8	1.16e-92	315	908	0.358	0.370	F1LVR8_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
18	A0A8I5ZKI6	2.96e-88	303	901	0.351	0.365	A0A8I5ZKI6_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
19	A0A087X287	3.53e-84	290	799	0.264	0.310	A0A087X287_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
20	A0A087WU73	7.16e-84	291	882	0.258	0.274	A0A087WU73_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02755 RPEL	4e-08	43.9	RPEL repeat
2	PF02037 SAP	3.4e-06	38.0	SAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017743

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005105	0.988	Serum response factor (c-fos serum response element-binding transcription factor)
2	61853.ENSNLEP00000016642	0.793	Myocyte enhancer factor 2C
3	61853.ENSNLEP00000004167	0.768	ELK1, member of ETS oncogene family
4	61853.ENSNLEP00000000252	0.698	T-box 5
5	61853.ENSNLEP00000000107	0.691	Uncharacterized protein
6	61853.ENSNLEP00000018294	0.691	GATA binding protein 4
7	61853.ENSNLEP00000015776	0.669	Mothers against decapentaplegic homolog
8	61853.ENSNLEP00000018748	0.655	E1A binding protein p300
9	61853.ENSNLEP00000008955	0.646	Transgelin
10	61853.ENSNLEP00000000534	0.644	NK2 homeobox 5
11	61853.ENSNLEP00000019858	0.644	Mesenchyme homeobox 2
12	61853.ENSNLEP00000014018	0.641	Signal transducer and activator of transcription 3 (acute-phase response factor)
13	61853.ENSNLEP00000001323	0.638	Uncharacterized protein
14	61853.ENSNLEP00000014883	0.619	Uncharacterized protein
15	61853.ENSNLEP00000001102	0.611	Myocyte enhancer factor 2A
16	61853.ENSNLEP00000001358	0.599	Calponin 2
17	61853.ENSNLEP00000006711	0.590	Histone deacetylase
18	61853.ENSNLEP00000013635	0.577	Calponin
19	61853.ENSNLEP00000022691	0.572	annotation not available
20	61853.ENSNLEP00000008116	0.564	Heart and neural crest derivatives expressed 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0003700	0.670	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0048522	0.992	positive regulation of cellular process
GO:0080090	0.990	regulation of primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0009987	0.988	cellular process
GO:0030154	0.980	cell differentiation
GO:0072359	0.979	circulatory system development
GO:0010468	0.977	regulation of gene expression
GO:0009893	0.975	positive regulation of metabolic process
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0007507	0.974	heart development
GO:0019219	0.968	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0061061	0.963	muscle structure development
GO:0051173	0.963	positive regulation of nitrogen compound metabolic process
GO:0031325	0.958	positive regulation of cellular metabolic process
GO:0006355	0.958	regulation of DNA-templated transcription
GO:0050896	0.951	response to stimulus
GO:0045935	0.949	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.938	negative regulation of biological process
GO:0051145	0.933	smooth muscle cell differentiation
GO:0006357	0.925	regulation of transcription by RNA polymerase II
GO:0009891	0.924	positive regulation of biosynthetic process
GO:0051239	0.914	regulation of multicellular organismal process
GO:0045893	0.905	positive regulation of DNA-templated transcription
GO:0050793	0.903	regulation of developmental process
GO:0045944	0.895	positive regulation of transcription by RNA polymerase II
GO:0045595	0.893	regulation of cell differentiation
GO:0048523	0.887	negative regulation of cellular process
GO:0051094	0.885	positive regulation of developmental process
GO:0010605	0.864	negative regulation of macromolecule metabolic process
GO:0051147	0.838	regulation of muscle cell differentiation
GO:0035051	0.802	cardiocyte differentiation
GO:0051172	0.761	negative regulation of nitrogen compound metabolic process
GO:0031324	0.728	negative regulation of cellular metabolic process
GO:0051240	0.702	positive regulation of multicellular organismal process
GO:0065009	0.670	regulation of molecular function
GO:0042127	0.646	regulation of cell population proliferation
GO:0045597	0.639	positive regulation of cell differentiation
GO:0006950	0.627	response to stress
GO:0051246	0.627	regulation of protein metabolic process
GO:0051716	0.591	cellular response to stimulus
GO:0008152	0.499	metabolic process
GO:0042221	0.410	response to chemical
GO:0044093	0.390	positive regulation of molecular function
GO:0007154	0.385	cell communication
GO:0071704	0.377	organic substance metabolic process
GO:0044238	0.362	primary metabolic process
GO:0007165	0.351	signal transduction
GO:0009888	0.336	tissue development
GO:0048583	0.317	regulation of response to stimulus
GO:0009653	0.316	anatomical structure morphogenesis
GO:0010646	0.314	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.741	cytoplasm
GO:0070013	0.540	intracellular organelle lumen
GO:0031981	0.528	nuclear lumen
GO:0005654	0.484	nucleoplasm
GO:0032991	0.355	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]