StarFunc result for job id Q8IZS7

User Input

>input (167 residues)
MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLSEVSLQKYD
CPFSGTSFVVFSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
DWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IZS7	1.000	1.000	1.408E-29	167	1.000	1.000	Q8IZS7.pdb.gz	CLCL1_HUMAN Putative C-type lectin-like domain family 1 OS=Homo sapiens OX=9606 GN=CLECL1P PE=5 SV=1
2	AFDB:Q9NZS2	0.253	0.187	2.375E-2	231	0.156	0.113	Q9NZS2.pdb.gz	KLRF1_HUMAN Killer cell lectin-like receptor subfamily F member 1 OS=Homo sapiens OX=9606 GN=KLRF1 PE=1 SV=3
3	AFDB:Q9R007	0.280	0.249	8.041E-2	190	0.114	0.100	Q9R007.pdb.gz	CLC5A_MOUSE C-type lectin domain family 5 member A OS=Mus musculus OX=10090 GN=Clec5a PE=1 SV=2
4	PDB:7v99A	0.213	0.051	1.587E-1	991	0.060	0.010	7v99A.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
5	AFDB:A0A2R8QI78	0.215	0.092	2.134E-1	452	0.048	0.018	A0A2R8QI78.pdb.gz
6	AFDB:X6R2I3	0.212	0.075	3.475E-1	678	0.132	0.032	X6R2I3.pdb.gz	X6R2I3_HUMAN DNA polymerase iota (Fragment) OS=Homo sapiens OX=9606 GN=POLI PE=1 SV=2
7	AFDB:Q9Y118	0.152	0.084	3.694E-1	431	0.114	0.044	Q9Y118.pdb.gz	DPOD3_DROME DNA polymerase delta subunit 3 OS=Drosophila melanogaster OX=7227 GN=PolD3 PE=1 SV=1
8	AFDB:Q9BXN2	0.259	0.183	3.926E-1	247	0.132	0.089	Q9BXN2.pdb.gz	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
9	AFDB:Q18163	0.092	0.048	4.435E-1	766	0.090	0.020	Q18163.pdb.gz	DDRA_CAEEL Discoidin domain-containing receptor A OS=Caenorhabditis elegans OX=6239 GN=ddr-1 PE=2 SV=3
10	PDB:6w6kF	0.161	0.355	4.756E-1	57	0.036	0.105	6w6kF.pdb.gz	Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
11	PDB:7z4dB	0.153	0.033	5.373E-1	1259	0.054	0.007	7z4dB.pdb.gz	R-loop formation and conformational activation mechanisms of Cas9.
12	AFDB:Q9UNA4	0.229	0.074	5.661E-1	740	0.108	0.024	Q9UNA4.pdb.gz	POLI_HUMAN DNA polymerase iota OS=Homo sapiens OX=9606 GN=POLI PE=1 SV=3
13	AFDB:P10124	0.155	0.160	6.017E-1	158	0.102	0.108	P10124.pdb.gz	SRGN_HUMAN Serglycin OS=Homo sapiens OX=9606 GN=SRGN PE=1 SV=3
14	PDB:7z4dE	0.156	0.034	6.070E-1	1166	0.042	0.006	7z4dE.pdb.gz	R-loop formation and conformational activation mechanisms of Cas9.
15	PDB:6s1mC	0.146	0.164	6.858E-1	143	0.072	0.084	6s1mC.pdb.gz	Structure of the processive human Pol delta holoenzyme.
16	PDB:4zt9C	0.164	0.038	7.289E-1	1160	0.048	0.007	4zt9C.pdb.gz	A Cas9-guide RNA complex preorganized for target DNA recognition.
17	PDB:3jb9E	0.120	0.169	9.303E-1	98	0.066	0.112	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:2outA	0.140	0.169	9.888E-1	131	0.108	0.137	2outA.pdb.gz
19	PDB:7z4gB	0.183	0.038	1.262	1188	0.030	0.004	7z4gB.pdb.gz	R-loop formation and conformational activation mechanisms of Cas9.
20	PDB:6umxA	0.113	0.083	1.426	279	0.090	0.054	6umxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IZS7	1.01e-123	346	167	1.000	1.000	CLCL1_HUMAN Putative C-type lectin-like domain family 1 OS=Homo sapiens OX=9606 GN=CLECL1P PE=5 SV=1
2	D3W0D1	9.45e-07	48.9	207	0.114	0.092	KLRF2_HUMAN Killer cell lectin-like receptor subfamily F member 2 OS=Homo sapiens OX=9606 GN=KLRF2 PE=1 SV=1
3	A9XX86	3.30e-05	45.1	381	0.102	0.045	A9XX86_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
4	F6QSC4	3.60e-05	45.1	374	0.102	0.045	F6QSC4_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 (Fragment) OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
5	Q8JZN1	4.85e-05	44.7	332	0.102	0.051	Q8JZN1_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
6	P27814	5.37e-05	43.9	223	0.096	0.072	KLRBC_MOUSE Killer cell lectin-like receptor subfamily B member 1C OS=Mus musculus OX=10090 GN=Klrb1c PE=1 SV=2
7	P49300	5.98e-05	44.3	304	0.102	0.056	CLC10_MOUSE C-type lectin domain family 10 member A OS=Mus musculus OX=10090 GN=Clec10a PE=1 SV=1
8	P07307	9.89e-05	43.5	311	0.102	0.055	ASGR2_HUMAN Asialoglycoprotein receptor 2 OS=Homo sapiens OX=9606 GN=ASGR2 PE=1 SV=2
9	P27812	6.34e-04	40.8	223	0.096	0.072	KRBBA_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele A OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
10	O54707	0.002	39.3	179	0.150	0.140	KLRD1_MOUSE Natural killer cells antigen CD94 OS=Mus musculus OX=10090 GN=Klrd1 PE=2 SV=1
11	Q8IUN9	0.002	39.7	316	0.102	0.054	CLC10_HUMAN C-type lectin domain family 10 member A OS=Homo sapiens OX=9606 GN=CLEC10A PE=1 SV=1
12	Q9UMR7	0.003	38.9	237	0.102	0.072	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
13	A4D1U7	0.004	38.5	188	0.144	0.128	A4D1U7_HUMAN C-type (Calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5 OS=Homo sapiens OX=9606 GN=CLECSF5 PE=2 SV=1
14	C9JPR7	0.004	38.1	155	0.156	0.168	C9JPR7_HUMAN C-type lectin domain containing 5A OS=Homo sapiens OX=9606 GN=CLEC5A PE=1 SV=1
15	Q9NY25	0.004	38.5	188	0.144	0.128	CLC5A_HUMAN C-type lectin domain family 5 member A OS=Homo sapiens OX=9606 GN=CLEC5A PE=1 SV=1
16	Q07108	0.005	38.5	199	0.120	0.101	CD69_HUMAN Early activation antigen CD69 OS=Homo sapiens OX=9606 GN=CD69 PE=1 SV=1
17	Q14DL9	0.006	37.7	165	0.150	0.152	Q14DL9_HUMAN C-type lectin domain containing 5A OS=Homo sapiens OX=9606 GN=CLEC5A PE=1 SV=1
18	O70215	0.008	37.7	215	0.120	0.093	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
19	Q0ZUP1	0.008	37.7	214	0.090	0.070	KLRB1_MOUSE Killer cell lectin-like receptor subfamily B member 1 OS=Mus musculus OX=10090 GN=Klrb1 PE=2 SV=1
20	P27811	0.013	37.4	227	0.090	0.066	KLRBA_MOUSE Killer cell lectin-like receptor subfamily B member 1A OS=Mus musculus OX=10090 GN=Klrb1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14324 PINIT	2.5e+02	13.5	PINIT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483624

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377086	0.707	LON peptidase N-terminal domain and ring finger 2
2	9606.ENSP00000264249	0.640	Carbohydrate sulfotransferase 10
3	9606.ENSP00000348849	0.633	Ribosomal protein S26
4	9606.ENSP00000261340	0.627	C-type lectin domain family 2 member D
5	9606.ENSP00000228434	0.607	Early activation antigen CD69
6	9606.ENSP00000484431	0.552	CD48 antigen
7	9606.ENSP00000296513	0.548	Adenosine deaminase domain-containing protein 1
8	9606.ENSP00000347916	0.532	C-type lectin domain family 12 member A
9	9606.ENSP00000333919	0.525	B- and T-lymphocyte attenuator
10	9606.ENSP00000234313	0.508	Pleckstrin
11	9606.ENSP00000326407	0.508	C-type lectin domain family 1 member A
12	9606.ENSP00000320084	0.505	CD276 antigen
13	9606.ENSP00000356033	0.500	T-cell activation Rho GTPase-activating protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.442	molecular transducer activity
GO:0038023	0.369	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0048522	0.974	positive regulation of cellular process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0051249	0.961	regulation of lymphocyte activation
GO:0008284	0.946	positive regulation of cell population proliferation
GO:0001817	0.945	regulation of cytokine production
GO:0050670	0.943	regulation of lymphocyte proliferation
GO:0051251	0.935	positive regulation of lymphocyte activation
GO:0022407	0.926	regulation of cell-cell adhesion
GO:1903037	0.917	regulation of leukocyte cell-cell adhesion
GO:0050863	0.917	regulation of T cell activation
GO:0050671	0.916	positive regulation of lymphocyte proliferation
GO:0050870	0.905	positive regulation of T cell activation
GO:0007155	0.902	cell adhesion
GO:0042129	0.896	regulation of T cell proliferation
GO:0042102	0.892	positive regulation of T cell proliferation
GO:0098609	0.890	cell-cell adhesion
GO:0009893	0.862	positive regulation of metabolic process
GO:0010604	0.841	positive regulation of macromolecule metabolic process
GO:0001819	0.833	positive regulation of cytokine production
GO:0007159	0.811	leukocyte cell-cell adhesion
GO:0050896	0.433	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043229	0.997	intracellular organelle
GO:0043232	0.899	intracellular non-membrane-bounded organelle
GO:0034451	0.801	centriolar satellite
GO:0043227	0.365	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]