StarFunc result for job id Q8IZS8

User Input

>input (1091 residues)
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITL
YDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQ
KLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE
SVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAQTVLL
LLPLLLMLFSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QYJ5	0.925	0.929	0.000	1087	0.530	0.532	F1QYJ5.pdb.gz
2	AFDB:Q7Z3S7	0.940	0.903	0.000	1137	0.592	0.568	Q7Z3S7.pdb.gz	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
3	AFDB:Q8CFG5	0.978	0.984	0.000	1085	0.971	0.976	Q8CFG5.pdb.gz	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
4	AFDB:A0A0B4K7P4	0.811	0.718	4.880E-100	1237	0.342	0.302	A0A0B4K7P4.pdb.gz	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
5	AFDB:Q8IP22	0.852	0.768	1.741E-96	1215	0.320	0.287	Q8IP22.pdb.gz	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
6	AFDB:A0A0B4K866	0.816	0.705	5.004E-96	1271	0.342	0.293	A0A0B4K866.pdb.gz	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
7	AFDB:X2J9Z3	0.846	0.732	1.187E-94	1271	0.306	0.263	X2J9Z3.pdb.gz	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
8	AFDB:E7F4T2	0.774	0.774	1.051E-84	1091	0.273	0.273	E7F4T2.pdb.gz	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
9	AFDB:A0A2R8QDT8	0.750	0.730	5.117E-84	1125	0.276	0.268	A0A2R8QDT8.pdb.gz
10	AFDB:Q8CFG6	0.776	0.735	7.550E-83	1157	0.282	0.266	Q8CFG6.pdb.gz	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
11	PDB:6jp8F	0.731	0.814	1.490E-75	973	0.259	0.291	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
12	PDB:5y58B	0.113	0.203	6.344E-6	568	0.047	0.090	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
13	PDB:6sn1B	0.137	0.268	9.179E-6	503	0.039	0.085	6sn1B.pdb.gz
14	PDB:1m2vA	0.130	0.189	1.729E-5	705	0.042	0.065	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
15	PDB:6gym6	0.137	0.402	2.931E-5	335	0.027	0.087	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
16	PDB:7ad8D	0.132	0.463	3.090E-5	280	0.027	0.107	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:4nenA	0.152	0.156	8.878E-5	1063	0.047	0.048	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
18	PDB:7k0yC	0.121	0.187	9.867E-5	655	0.060	0.099	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
19	PDB:4nehA	0.129	0.130	1.587E-4	1084	0.050	0.051	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
20	PDB:2xwbF	0.130	0.186	1.672E-4	714	0.046	0.070	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7P4	0.0	570	1237	0.349	0.308	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
2	Q7K0H4	0.0	578	1218	0.346	0.310	Q7K0H4_DROME SD07723p OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
3	Q7Z3S7	0.0	1375	1137	0.588	0.564	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
4	Q8CFG5	0.0	2202	1085	0.973	0.978	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
5	A0A0B4K866	2.34e-178	558	1271	0.350	0.301	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
6	Q8IP22	6.52e-164	518	1215	0.335	0.300	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
7	Q9NY47	1.72e-131	430	1150	0.295	0.280	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
8	Q6PHS9	4.33e-130	426	1154	0.295	0.279	CA2D2_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1
9	Q8CFG6	8.36e-128	420	1157	0.294	0.277	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
10	O08532	2.89e-125	412	1103	0.302	0.299	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
11	P13806	2.07e-123	407	1106	0.295	0.291	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
12	P54289	1.54e-122	405	1103	0.302	0.298	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
13	Q5TZ68	1.89e-121	401	1069	0.290	0.296	Q5TZ68_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
14	E7F4T2	1.20e-120	399	1091	0.286	0.286	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
15	X2J9Z3	1.63e-119	400	1271	0.213	0.183	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
16	P54290	1.76e-117	391	1091	0.297	0.297	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
17	Q95R75	1.05e-101	342	842	0.225	0.292	Q95R75_DROME SD03196p OS=Drosophila melanogaster OX=7227 GN=stj PE=2 SV=1
18	G4S4A1	2.57e-71	261	1205	0.207	0.188	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
19	P34374	1.80e-66	247	1249	0.207	0.181	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2
20	Q61703	6.90e-08	59.3	946	0.046	0.053	ITIH2_MOUSE Inter-alpha-trypsin inhibitor heavy chain H2 OS=Mus musculus OX=10090 GN=Itih2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17201 Cache_3-Cache_2	76	14.2	Cache 3/Cache 2 fusion domain
2	PF02743 dCache_1	1.9e-06	39.1	Cache domain
3	PF08269 dCache_2	15	16.3	Cache domain
4	PF09682 Phage_holin_6_1	6.2e+02	12.2	Bacteriophage holin of superfamily 6 (Holin_LLH)
5	PF08473 VGCC_alpha2	1.4e-34	131.4	Neuronal voltage-dependent calcium channel alpha 2acd
6	PF00092 VWA	1.1e-05	37.3	von Willebrand factor type A domain
7	PF13519 VWA_2	1.9e-05	36.6	von Willebrand factor type A domain
8	PF13768 VWA_3	2.5e-10	52.0	von Willebrand factor type A domain
9	PF05762 VWA_CoxE	1.6e+02	13.0	VWA domain containing CoxE-like protein
10	PF08399 VWA_N	1.1e-34	131.0	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419101

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226021	0.941	Voltage-dependent calcium channel gamma-1 subunit
2	9606.ENSP00000377840	0.937	Voltage-dependent L-type calcium channel subunit beta-1
3	9606.ENSP00000353362	0.903	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
4	9606.ENSP00000320025	0.893	Voltage-dependent L-type calcium channel subunit beta-2
5	9606.ENSP00000438949	0.891	Voltage-dependent L-type calcium channel subunit beta-4
6	9606.ENSP00000301050	0.873	Voltage-dependent L-type calcium channel subunit beta-3
7	9606.ENSP00000356545	0.855	Voltage-dependent R-type calcium channel subunit alpha-1E
8	9606.ENSP00000288139	0.849	Voltage-dependent L-type calcium channel subunit alpha-1D
9	9606.ENSP00000360423	0.848	Voltage-dependent N-type calcium channel subunit alpha-1B
10	9606.ENSP00000266376	0.837	Voltage-dependent L-type calcium channel subunit alpha-1C
11	9606.ENSP00000365441	0.802	Voltage-dependent L-type calcium channel subunit alpha-1F
12	9606.ENSP00000262138	0.793	Voltage-dependent calcium channel gamma-4 subunit
13	9606.ENSP00000352011	0.790	Voltage-dependent T-type calcium channel subunit alpha-1G
14	9606.ENSP00000334198	0.779	Voltage-dependent T-type calcium channel subunit alpha-1H
15	9606.ENSP00000355192	0.774	Voltage-dependent L-type calcium channel subunit alpha-1S
16	9606.ENSP00000381412	0.740	Calcium/calmodulin-dependent protein kinase type II subunit alpha
17	9606.ENSP00000339740	0.737	Calcium/calmodulin-dependent protein kinase type II subunit delta
18	9606.ENSP00000300105	0.708	Voltage-dependent calcium channel gamma-2 subunit
19	9606.ENSP00000278520	0.694	Coiled-coil domain containing 82
20	9606.ENSP00000368447	0.685	GPALPP motifs containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005246	0.999	calcium channel regulator activity
GO:0005515	0.661	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050896	0.958	response to stimulus
GO:0006811	0.933	monoatomic ion transport
GO:0030001	0.897	metal ion transport
GO:0006816	0.850	calcium ion transport
GO:0051716	0.818	cellular response to stimulus
GO:0050789	0.811	regulation of biological process
GO:0071417	0.717	cellular response to organonitrogen compound
GO:0050794	0.691	regulation of cellular process
GO:1901652	0.639	response to peptide
GO:0032501	0.560	multicellular organismal process
GO:1901701	0.406	cellular response to oxygen-containing compound
GO:0007154	0.311	cell communication
GO:0023052	0.302	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0034703	0.996	cation channel complex
GO:0098797	0.990	plasma membrane protein complex
GO:0034704	0.987	calcium channel complex
GO:0005891	0.983	voltage-gated calcium channel complex
GO:0005622	0.901	intracellular anatomical structure
GO:0043226	0.748	organelle
GO:0043227	0.733	membrane-bounded organelle
GO:0005737	0.699	cytoplasm
GO:0043229	0.675	intracellular organelle
GO:0043231	0.659	intracellular membrane-bounded organelle
GO:0012505	0.335	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]