StarFunc result for job id Q8IZT6

User Input

>input (1400 residues)
MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGAS
RTLSLALDNPNEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVRE
IMTFLVNDVLKHQAILLGNAEEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFS
VSQKVDRVRSPLQACENLAMNEGGPPTENNSLILEENKIPISPISPAFNECHGATCLPLS
VRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETSFNSVNVNGQRGENSKLSLTP
NCSSTLNITQSQIHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSQPVHLESTIAHE
IYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS
QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISS
HSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKED
FHSYLPIIDPILSKSKSYKNEVTPSSTTASVARKRKSDGSMEDANVRVAITEHTEVREIK
RIHFSPSEPKTSAVKKTKNVTTPISKRISNREKLNLKKKTDLSIFRTPISKTNKRTKPII
AVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKT
NISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVK
AIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED
NSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYA
KISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDE
FDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRG
IELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIK
KTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSD
GRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHE
NTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL
LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAAL
VIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSR
IRMIIAVTSYKRYLWATVTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VC45	0.215	0.158	4.201E-39	1954	0.202	0.145	Q9VC45.pdb.gz	ASP_DROME Protein abnormal spindle OS=Drosophila melanogaster OX=7227 GN=asp PE=1 SV=3
2	AFDB:Q1JQ46	0.098	0.223	6.421E-15	573	0.111	0.272	Q1JQ46.pdb.gz
3	PDB:7sqcO1	0.064	0.129	1.955E-4	673	0.013	0.027	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
4	PDB:7sqcO0	0.067	0.082	2.246E-4	1140	0.014	0.018	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
5	PDB:4d1eA	0.126	0.201	2.702E-4	859	0.047	0.077	4d1eA.pdb.gz
6	PDB:4lk4A	0.058	0.232	3.251E-4	326	0.011	0.046	4lk4A.pdb.gz
7	PDB:7sx8D	0.118	0.326	2.064E-3	448	0.053	0.165	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
8	PDB:5ghuA	0.056	0.333	5.202E-3	201	0.008	0.055	5ghuA.pdb.gz
9	PDB:7q5zA	0.060	0.062	7.529E-3	1344	0.009	0.010	7q5zA.pdb.gz
10	AFDB:Q7Z5K2	0.070	0.078	1.289E-2	1190	0.111	0.131	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
11	PDB:3sqbE	0.054	0.319	1.311E-2	176	0.009	0.068	3sqbE.pdb.gz
12	PDB:7kveB	0.051	0.051	1.373E-2	1374	0.012	0.012	7kveB.pdb.gz
13	PDB:3qqxA	0.042	0.108	1.438E-2	474	0.010	0.030	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
14	AFDB:F4HWC3	0.041	0.042	2.829E-2	1364	0.134	0.138	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
15	AFDB:P25822	0.063	0.059	3.564E-2	1533	0.113	0.103	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
16	AFDB:A0A0R4IZ84	0.071	0.066	8.188E-2	1544	0.091	0.082	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
17	AFDB:D3ZEB1	0.049	0.034	1.132E-1	2257	0.058	0.036	D3ZEB1.pdb.gz	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
18	AFDB:Q91ZV0	0.052	0.052	1.426E-1	1396	0.119	0.119	Q91ZV0.pdb.gz	MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mus musculus OX=10090 GN=Mia2 PE=1 SV=3
19	AFDB:Q80XI3	0.060	0.055	1.493E-1	1579	0.096	0.085	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
20	AFDB:A8DZ29	0.052	0.041	1.715E-1	1919	0.106	0.077	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4INR1	0.0	966	3391	0.333	0.137	A0A0R4INR1_DANRE Abnormal spindle-like microcephaly-associated protein OS=Danio rerio OX=7955 GN=fc13b04 PE=4 SV=1
2	D3ZZQ1	0.0	1688	2944	0.603	0.287	D3ZZQ1_RAT Assembly factor for spindle microtubules OS=Rattus norvegicus OX=10116 GN=Aspm PE=4 SV=3
3	Q8CJ27	0.0	1935	3122	0.694	0.311	ASPM_MOUSE Abnormal spindle-like microcephaly-associated protein homolog OS=Mus musculus OX=10090 GN=Aspm PE=1 SV=2
4	Q8IZT6	0.0	2949	3477	1.000	0.403	ASPM_HUMAN Abnormal spindle-like microcephaly-associated protein OS=Homo sapiens OX=9606 GN=ASPM PE=1 SV=2
5	Q9VC45	4.06e-76	281	1954	0.110	0.079	ASP_DROME Protein abnormal spindle OS=Drosophila melanogaster OX=7227 GN=asp PE=1 SV=3
6	O17666	2.55e-16	87.4	1186	0.060	0.071	O17666_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aspm-1 PE=1 SV=1
7	E7F8G7	2.17e-11	71.6	4762	0.056	0.016	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
8	A0A286YBE9	2.19e-11	71.6	4773	0.056	0.016	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
9	A5WV02	2.22e-11	71.6	4577	0.056	0.017	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
10	A0A2R8RIJ1	2.26e-11	71.6	4599	0.056	0.017	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
11	A0A2R8PVX9	2.28e-11	71.6	4580	0.056	0.017	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
12	H0YDN1	1.46e-10	68.9	3447	0.055	0.022	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
13	G5EEC4	2.77e-10	68.2	3694	0.054	0.020	G5EEC4_CAEEL Nesprin-1 OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
14	G5EFM4	3.65e-10	67.8	3571	0.054	0.021	G5EFM4_CAEEL Nesprin-1 OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
15	G5ECG8	3.66e-10	67.4	3311	0.054	0.023	G5ECG8_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
16	G5ECP9	3.96e-10	67.4	3424	0.054	0.022	G5ECP9_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=1
17	G5EFK7	4.12e-10	67.4	3310	0.054	0.023	G5EFK7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
18	Q86NF9	4.42e-10	67.4	3436	0.054	0.022	Q86NF9_CAEEL VAB-10A protein OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=2 SV=1
19	G5EDD3	6.24e-10	67.0	4943	0.054	0.015	G5EDD3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
20	P13466	7.17e-10	66.2	857	0.056	0.092	GELA_DICDI Gelation factor OS=Dictyostelium discoideum OX=44689 GN=abpC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	8.5e-30	114.2	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF11971 CAMSAP_CH	0.0037	28.4	CAMSAP CH domain
3	PF00307 CH	4.7e-13	60.6	Calponin homology (CH) domain
4	PF06294 CH_2	29	16.1	CH-like domain in sperm protein
5	PF00612 IQ	0.03	25.1	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260731	0.996	Kinesin-like protein KIF11
2	9606.ENSP00000251496	0.995	Condensin complex subunit 3
3	9606.ENSP00000260363	0.994	Kinesin-like protein KIF23
4	9606.ENSP00000265148	0.994	Centromere-associated protein E
5	9606.ENSP00000378699	0.994	Cyclin-dependent kinase 1
6	9606.ENSP00000302530	0.993	Mitotic checkpoint serine/threonine-protein kinase BUB1
7	9606.ENSP00000358813	0.993	Dual specificity protein kinase TTK
8	9606.ENSP00000247191	0.992	Disks large-associated protein 5
9	9606.ENSP00000453403	0.991	Nucleolar and spindle-associated protein 1
10	9606.ENSP00000349961	0.989	Structural maintenance of chromosomes protein 4
11	9606.ENSP00000274026	0.988	Cyclin-A2
12	9606.ENSP00000411532	0.987	DNA topoisomerase 2-alpha
13	9606.ENSP00000361540	0.986	Cell division cycle protein 20 homolog
14	9606.ENSP00000355922	0.985	Centromere protein F
15	9606.ENSP00000357643	0.985	Proliferation marker protein Ki-67
16	9606.ENSP00000261597	0.983	Kinetochore protein NDC80 homolog
17	9606.ENSP00000335463	0.982	Kinetochore scaffold 1
18	9606.ENSP00000363524	0.982	Chromosome-associated kinesin KIF4A
19	9606.ENSP00000296509	0.981	Mitotic spindle assembly checkpoint protein MAD2A
20	9606.ENSP00000300403	0.981	Targeting protein for Xklp2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	0.997	calmodulin binding
GO:0008092	0.970	cytoskeletal protein binding
GO:0008017	0.848	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007049	0.992	cell cycle
GO:0051640	0.967	organelle localization
GO:0007010	0.883	cytoskeleton organization
GO:0022402	0.793	cell cycle process
GO:0007017	0.686	microtubule-based process
GO:0051653	0.639	spindle localization
GO:0000226	0.600	microtubule cytoskeleton organization
GO:0007051	0.583	spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0097431	0.997	mitotic spindle pole
GO:0005634	0.990	nucleus
GO:0005874	0.959	microtubule
GO:0005737	0.850	cytoplasm
GO:0005829	0.405	cytosol
GO:0043233	0.378	organelle lumen
GO:0070013	0.371	intracellular organelle lumen
GO:0031981	0.308	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]