StarFunc result for job id Q8IZU2

User Input

>input (1322 residues)
MAWMTYISNWFEQDDWYEGLQRANMSQVRQVGLLAAGCQPWNKDVCAASGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASGSTDNLVIIWNVAEQKVIA
KLDSTKGIPASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFR
WHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLSTDYLL
VVNLHYGIRLVDSESLSCITTFNLPSAAASVQCLAWVPSAPGMFITGDSQVGVLRIWNVS
RTTPIDNLKLKKTGFHCLHVLNSPPRKKFSVQSPTKNHYTSSTSEAVPPPTLTQNQAFSL
PPGHAVCCFLDGGVGLYDMGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGGLNCIAGGTSRNGAFIWNVQKGKIIQRFNEHGT
NGIFCIAWSHKDSKRIATCSSDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDTNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLREGILCSGSDDGTVRIWDYTQDA
CINILNGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTREGTCVDTVYDHGADVYGLTC
HPSRPFTMASCSRDSTVRLWSLTALVTPVQINILADRSWEEIIGNTDYAIEPGTPPLLCG
KVSRDIRQEIEKLTANSQVKKLRWFSECLSPPGGSDNLWNLVAVIKGQDDSLLPQNYCKG
IMHLKHLIKFRTSEAQELTTVKMSKFGGGIGVPAKEERLKEAAEIHLRLGQIQRYCELMV
ELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDDVIPYCIAIGDVKKLVHFFMSRG
QLKEALLVAQAACEGNMQPLHVSVPKGASYSDDIYKEDFNELLHKVSKELAEWYFQDGRA
VLAACCHLAIDNIELAMAYLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISV
CFPCVGYSVPFCYVNRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPTVE
ECMQLAETARADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLL
SYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRREVSVP
LKIEYLSEELDAWRACTQSTNRSLEDSPYTPPSDSQRMIYATLLKRLKEESLKGIIGPDY
VTGSNLPSHSDIHISCLTGLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLN
PF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BX17	0.398	0.353	2.063E-33	1502	0.166	0.146	Q8BX17.pdb.gz	GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus OX=10090 GN=Gemin5 PE=1 SV=2
2	AFDB:Q8TEQ6	0.397	0.351	2.703E-32	1508	0.155	0.136	Q8TEQ6.pdb.gz	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
3	AFDB:Q9LFE2	0.347	0.490	5.947E-32	876	0.114	0.172	Q9LFE2.pdb.gz	TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE OS=Arabidopsis thaliana OX=3702 GN=TOZ PE=1 SV=1
4	AFDB:E9QH84	0.381	0.351	1.308E-31	1440	0.141	0.130	E9QH84.pdb.gz	E9QH84_DANRE Gem (nuclear organelle)-associated protein 5 OS=Danio rerio OX=7955 GN=gemin5 PE=1 SV=1
5	AFDB:Q5U3Q5	0.343	0.474	5.829E-31	897	0.115	0.169	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
6	AFDB:Q12788	0.331	0.498	9.018E-30	808	0.104	0.170	Q12788.pdb.gz	TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2
7	AFDB:Q9C1X1	0.329	0.470	1.338E-28	854	0.084	0.130	Q9C1X1.pdb.gz	PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.04c PE=1 SV=1
8	AFDB:Q15269	0.338	0.456	6.753E-28	919	0.085	0.122	Q15269.pdb.gz	PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=1 SV=2
9	AFDB:Q5A756	0.261	0.338	1.258E-27	981	0.107	0.145	Q5A756.pdb.gz	Q5A756_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DIP2 PE=4 SV=1
10	AFDB:Q5A852	0.321	0.431	1.683E-27	922	0.083	0.119	Q5A852.pdb.gz	Q5A852_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PWP2 PE=3 SV=1
11	PDB:7mq8LR	0.336	0.521	3.081E-27	773	0.102	0.175	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaLO	0.339	0.506	4.969E-26	819	0.081	0.131	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8LO	0.332	0.481	1.188E-25	848	0.081	0.126	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLQ	0.307	0.446	4.870E-25	830	0.104	0.166	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8LT	0.304	0.419	5.291E-25	869	0.098	0.150	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6lqsB1	0.326	0.490	4.579E-24	806	0.095	0.156	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:7ajtUA	0.324	0.475	2.040E-23	834	0.085	0.135	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7d5sBE	0.304	0.419	2.616E-23	865	0.101	0.155	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:7ajtUM	0.323	0.506	2.963E-23	762	0.104	0.180	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7d5sB2	0.306	0.429	3.356E-23	851	0.093	0.145	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ87	8.39e-27	119	522	0.079	0.201	TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens OX=9606 GN=TBL1Y PE=1 SV=1
2	O60907	6.05e-26	116	577	0.079	0.180	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
3	Q9QXE7	1.07e-25	115	527	0.067	0.167	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2
4	Q9BZK7	2.64e-25	114	514	0.072	0.185	TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1
5	Q8BHJ5	2.71e-25	114	514	0.072	0.185	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
6	Q95RJ9	7.36e-23	107	700	0.067	0.127	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
7	Q9VPR4	4.69e-22	103	488	0.070	0.189	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
8	Q93794	1.15e-21	103	587	0.061	0.138	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
9	B7ZDC8	2.21e-21	102	544	0.059	0.143	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
10	Q8VBV4	2.80e-21	102	710	0.059	0.110	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
11	Q969H0	2.95e-21	102	707	0.059	0.110	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
12	Q9FN19	6.12e-21	101	613	0.064	0.137	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
13	O00628	1.60e-20	96.7	323	0.054	0.220	PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens OX=9606 GN=PEX7 PE=1 SV=1
14	Q8R537	1.86e-20	96.3	318	0.055	0.230	PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus OX=10029 GN=PEX7 PE=1 SV=1
15	P97865	1.17e-19	94.0	318	0.054	0.226	PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus OX=10090 GN=Pex7 PE=1 SV=1
16	Q8N136	1.58e-18	92.0	415	0.061	0.195	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
17	Q57X86	2.71e-18	93.2	698	0.055	0.105	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
18	Q9VDE3	4.44e-18	91.7	510	0.058	0.151	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
19	A0A0B4KHK1	5.45e-18	92.0	597	0.058	0.129	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
20	Q57W14	9.10e-18	89.7	419	0.063	0.198	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	6.9e-17	72.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.036	25.5	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	60	14.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF20426 NBCH_WD40	8.3e-09	46.3	Neurobeachin beta propeller domain
5	PF11715 Nup160	2.5	18.4	Nucleoporin Nup120/160
6	PF00400 WD40	3.8e-27	105.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438264	0.804	Leucine rich repeat, Ig-like and transmembrane domains 2
2	9606.ENSP00000386499	0.787	Proline-rich protein 35
3	9606.ENSP00000304355	0.772	Coiled-coil domain containing 126
4	9606.ENSP00000373808	0.688	Soluble lamin-associated protein of 75 kDa
5	9606.ENSP00000375756	0.664	ATP-sensitive inward rectifier potassium channel 14
6	9606.ENSP00000427463	0.664	Signal peptidase complex subunit 3
7	9606.ENSP00000384018	0.652	Nuclear receptor corepressor 2
8	9606.ENSP00000481185	0.641	Grifin
9	9606.ENSP00000268712	0.640	Nuclear receptor corepressor 1
10	9606.ENSP00000284690	0.634	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
11	9606.ENSP00000301190	0.634	Photoreceptor ankyrin repeat protein
12	9606.ENSP00000296525	0.603	Ankyrin repeat and SOCS box protein 5
13	9606.ENSP00000361177	0.600	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
14	9606.ENSP00000280191	0.592	Spermatogenesis-associated protein 4
15	9606.ENSP00000389427	0.571	Centrosomal protein 44
16	9606.ENSP00000388502	0.567	Zinc finger protein 583
17	9606.ENSP00000251268	0.560	Multiple epidermal growth factor-like domains protein 8
18	9606.ENSP00000326531	0.558	THO complex subunit 6 homolog
19	9606.ENSP00000280187	0.546	Neuronal membrane glycoprotein M6-a
20	9606.ENSP00000451211	0.539	Protein NEDD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.973	regulation of biological process
GO:0050794	0.956	regulation of cellular process
GO:0019222	0.829	regulation of metabolic process
GO:0071840	0.786	cellular component organization or biogenesis
GO:0060255	0.715	regulation of macromolecule metabolic process
GO:0031323	0.618	regulation of cellular metabolic process
GO:0016043	0.613	cellular component organization
GO:0051171	0.587	regulation of nitrogen compound metabolic process
GO:0080090	0.585	regulation of primary metabolic process
GO:0071704	0.582	organic substance metabolic process
GO:0044238	0.558	primary metabolic process
GO:0006807	0.507	nitrogen compound metabolic process
GO:0043170	0.458	macromolecule metabolic process
GO:0010468	0.437	regulation of gene expression
GO:1901564	0.383	organonitrogen compound metabolic process
GO:0009889	0.378	regulation of biosynthetic process
GO:0044237	0.359	cellular metabolic process
GO:0010556	0.337	regulation of macromolecule biosynthetic process
GO:0031326	0.337	regulation of cellular biosynthetic process
GO:0048518	0.334	positive regulation of biological process
GO:0019538	0.318	protein metabolic process
GO:0048519	0.311	negative regulation of biological process
GO:0050896	0.310	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0016020	0.995	membrane
GO:0032991	0.980	protein-containing complex
GO:0005829	0.962	cytosol
GO:0005634	0.951	nucleus
GO:0070013	0.661	intracellular organelle lumen
GO:0140513	0.641	nuclear protein-containing complex
GO:0031981	0.548	nuclear lumen
GO:0043232	0.499	intracellular non-membrane-bounded organelle
GO:0005654	0.392	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]