StarFunc result for job id Q8IZU8

User Input

>input (1212 residues)
MALMFTGHLLFLALLMFAFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSM
LHPSLYFDAGEIQAMRQKSRASHLHLFRAIRSAVTVMLSNPTYYLPPPKHADFAAKWNEI
YGNNLPPLALYCLLCPEDKVAFEFVLEYMDRMVGYKDWLVENAPGDEVPIGHSLTGFATA
FDFLYNLLDNHRRQKYLEKIWVITEEMYEYSKVRSWGKQLLHNHQATNMIALLTGALVTG
VDKGSKANIWKQAVVDVMEKTMFLLNHIVDGSLDEGVAYGSYTAKSVTQYVFLAQRHFNI
NNLDNNWLKMHFWFYYATLLPGFQRTVGIADSNYNWFYGPESQLVFLDKFILKNGAGNWL
AQQIRKHRPKDGPMVPSTAQRWSTLHTEYIWYDPQLTPQPPADYGTAKIHTFPNWGVVTY
GAGLPNTQTNTFVSFKSGKLGGRAVYDIVHFQPYSWIDGWRSFNPGHEHPDQNSFTFAPN
GQVFVSEALYGPKLSHLNNVLVFAPSPSSQCNKPWEGQLGECAQWLKWTGEEVGDAAGEI
ITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSA
FFHNLDIDFKYIPYKFMNRYNGAMMDVWDAHYKMFWFDHHGNSPMASIQEAEQAAEFKKR
WTQFVNVTFQMEPTITRIAYVFYGPYINVSSCRFIDSSNPGLQISLNVNNTEHVVSIVTD
YHNLKTRFNYLGFGGFASVADQGQITRFGLGTQAIVKPVRHDRIIFPFGFKFNIAVGLIL
CISLVILTFQWRFYLSFRKLMRWILILVIALWFIELLDVWSTCSQPICAKWTRTEAEGSK
KSLSSEGHHMDLPDVVITSLPGSGAEILKQLFFNSSDFLYIRVPTAYIDIPETELEIDSF
VDACEWKVSDIRSGHFRLLRGWLQSLVQDTKLHLQNIHLHEPNRGKLAQYFAMNKDKKRK
FKRRESLPEQRSQMKGAFDRDAEYIRALRRHLVYYPSARPVLSLSSGSWTLKLHFFQEVL
GASMRALYIVRDPRAWIYSMLYNSKPSLYSLKNVPEHLAKLFKIEGGKGKCNLNSGYAFE
YEPLRKELSKSKSNAVSLLSHLWLANTAAALRINTDLLPTSYQLVKFEDIVHFPQKTTER
IFAFLGIPLSPASLNQILFATSTNLFYLPYEGEISPTNTNVWKQNLPRDEIKLIENICWT
LMDRLGYPKFMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VBN2	0.949	0.953	0.000	1207	0.893	0.896	Q0VBN2.pdb.gz	DSEL_MOUSE Dermatan-sulfate epimerase-like protein OS=Mus musculus OX=10090 GN=Dsel PE=2 SV=1
2	AFDB:Q8IZU8	1.000	1.000	0.000	1212	1.000	1.000	Q8IZU8.pdb.gz	DSEL_HUMAN Dermatan-sulfate epimerase-like protein OS=Homo sapiens OX=9606 GN=DSEL PE=2 SV=2
3	AFDB:P0C2H4	0.552	0.697	2.141E-70	958	0.303	0.383	P0C2H4.pdb.gz	DSE_BOVIN Dermatan-sulfate epimerase OS=Bos taurus OX=9913 GN=DSE PE=1 SV=1
4	PDB:2fuqA	0.358	0.542	1.242E-17	747	0.076	0.123	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
5	PDB:4mmhA	0.328	0.560	4.296E-13	637	0.064	0.122	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
6	AFDB:Q9NS84	0.188	0.415	2.030E-7	486	0.070	0.175	Q9NS84.pdb.gz	CHST7_HUMAN Carbohydrate sulfotransferase 7 OS=Homo sapiens OX=9606 GN=CHST7 PE=1 SV=2
7	AFDB:O43916	0.195	0.494	2.124E-7	411	0.060	0.178	O43916.pdb.gz	CHST1_HUMAN Carbohydrate sulfotransferase 1 OS=Homo sapiens OX=9606 GN=CHST1 PE=1 SV=1
8	AFDB:Q9QZL2	0.171	0.386	4.367E-7	474	0.061	0.156	Q9QZL2.pdb.gz	CHST3_RAT Carbohydrate sulfotransferase 3 OS=Rattus norvegicus OX=10116 GN=Chst3 PE=2 SV=2
9	AFDB:Q9EP78	0.191	0.424	6.851E-7	484	0.067	0.167	Q9EP78.pdb.gz	CHST7_MOUSE Carbohydrate sulfotransferase 7 OS=Mus musculus OX=10090 GN=Chst7 PE=2 SV=1
10	AFDB:Q7LGC8	0.173	0.381	3.169E-6	479	0.063	0.159	Q7LGC8.pdb.gz	CHST3_HUMAN Carbohydrate sulfotransferase 3 OS=Homo sapiens OX=9606 GN=CHST3 PE=1 SV=3
11	AFDB:O60704	0.131	0.375	8.932E-6	377	0.055	0.178	O60704.pdb.gz	TPST2_HUMAN Protein-tyrosine sulfotransferase 2 OS=Homo sapiens OX=9606 GN=TPST2 PE=1 SV=1
12	AFDB:O60507	0.136	0.406	1.921E-5	370	0.052	0.170	O60507.pdb.gz	TPST1_HUMAN Protein-tyrosine sulfotransferase 1 OS=Homo sapiens OX=9606 GN=TPST1 PE=1 SV=1
13	PDB:1q1qA	0.103	0.374	3.729E-3	278	0.035	0.155	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
14	PDB:1zrhA	0.119	0.413	7.667E-3	263	0.031	0.144	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
15	PDB:5gw7B	0.072	0.110	8.390E-3	760	0.012	0.018	5gw7B.pdb.gz	Crystal structure of the enzyme-product complex reveals sugar ring distortion during catalysis by family 63 inverting alpha-glycosidase
16	PDB:1j99A	0.098	0.352	1.203E-2	284	0.030	0.127	1j99A.pdb.gz	Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
17	PDB:7vqoA	0.114	0.117	1.888E-2	1180	0.033	0.034	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
18	PDB:7dd9A	0.082	0.086	1.975E-2	1129	0.051	0.055	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
19	PDB:2cirA	0.094	0.313	2.260E-2	288	0.027	0.115	2cirA.pdb.gz	Structure-based functional annotation: yeast ymr099c codes for a D-hexose-6-phosphate mutarotase.
20	PDB:7eovA	0.111	0.416	2.364E-2	274	0.038	0.168	7eovA.pdb.gz	The crystal structure of mouse SULT2A8 reveals the mechanism of 7 alpha-hydroxyl, bile acid sulfation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C2H4	0.0	660	958	0.271	0.342	DSE_BOVIN Dermatan-sulfate epimerase OS=Bos taurus OX=9913 GN=DSE PE=1 SV=1
2	Q0VBN2	0.0	2259	1207	0.894	0.897	DSEL_MOUSE Dermatan-sulfate epimerase-like protein OS=Mus musculus OX=10090 GN=Dsel PE=2 SV=1
3	Q8IZU8	0.0	2532	1212	1.000	1.000	DSEL_HUMAN Dermatan-sulfate epimerase-like protein OS=Homo sapiens OX=9606 GN=DSEL PE=2 SV=2
4	Q9UL01	0.0	659	958	0.269	0.340	DSE_HUMAN Dermatan-sulfate epimerase OS=Homo sapiens OX=9606 GN=DSE PE=1 SV=1
5	Q9Y4C5	1.22e-04	48.5	530	0.038	0.087	CHST2_HUMAN Carbohydrate sulfotransferase 2 OS=Homo sapiens OX=9606 GN=CHST2 PE=1 SV=2
6	V9HVX9	1.22e-04	48.5	530	0.038	0.087	V9HVX9_HUMAN Sulfotransferase OS=Homo sapiens OX=9606 GN=HEL-S-75 PE=2 SV=1
7	Q80WV3	1.76e-04	48.1	530	0.038	0.087	CHST2_MOUSE Carbohydrate sulfotransferase 2 OS=Mus musculus OX=10090 GN=Chst2 PE=1 SV=3
8	O43916	0.002	44.7	411	0.024	0.071	CHST1_HUMAN Carbohydrate sulfotransferase 1 OS=Homo sapiens OX=9606 GN=CHST1 PE=1 SV=1
9	Q9QUP4	0.012	42.0	395	0.035	0.109	CHST5_MOUSE Carbohydrate sulfotransferase 5 OS=Mus musculus OX=10090 GN=Chst5 PE=2 SV=1
10	Q9GZS9	0.047	40.0	411	0.042	0.124	CHST5_HUMAN Carbohydrate sulfotransferase 5 OS=Homo sapiens OX=9606 GN=CHST5 PE=2 SV=3
11	Q9R1I1	0.075	39.3	388	0.017	0.054	CHST4_MOUSE Carbohydrate sulfotransferase 4 OS=Mus musculus OX=10090 GN=Chst4 PE=1 SV=1
12	Q9GZX3	0.13	38.5	395	0.042	0.129	CHST6_HUMAN Carbohydrate sulfotransferase 6 OS=Homo sapiens OX=9606 GN=CHST6 PE=1 SV=1
13	O88199	0.21	38.1	472	0.036	0.093	CHST3_MOUSE Carbohydrate sulfotransferase 3 OS=Mus musculus OX=10090 GN=Chst3 PE=1 SV=1
14	Q8NCG5	0.22	37.7	386	0.031	0.098	CHST4_HUMAN Carbohydrate sulfotransferase 4 OS=Homo sapiens OX=9606 GN=CHST4 PE=1 SV=2
15	Q7LGC8	0.67	36.6	479	0.033	0.084	CHST3_HUMAN Carbohydrate sulfotransferase 3 OS=Homo sapiens OX=9606 GN=CHST3 PE=1 SV=3
16	P34343	1.4	35.8	1129	0.031	0.033	NU133_CAEEL Nuclear pore complex protein 15 OS=Caenorhabditis elegans OX=6239 GN=npp-15 PE=3 SV=4
17	Q9EP78	2.1	35.0	484	0.018	0.045	CHST7_MOUSE Carbohydrate sulfotransferase 7 OS=Mus musculus OX=10090 GN=Chst7 PE=2 SV=1
18	P71986	6.0	33.1	256	0.016	0.074	P71986_MYCTU Glycoside hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1728c PE=1 SV=3
19	Q9QZL2	7.7	33.1	474	0.032	0.082	CHST3_RAT Carbohydrate sulfotransferase 3 OS=Rattus norvegicus OX=10116 GN=Chst3 PE=2 SV=2
20	Q13621	8.0	33.1	1099	0.027	0.030	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16332 DUF4962	2.6	18.1	Domain of unknown function (DUF4962)
2	PF07940 Hepar_II_III	1.7e+02	13.1	Heparinase II/III-like protein
3	PF00685 Sulfotransfer_1	3.1e-06	38.4	Sulfotransferase domain
4	PF13469 Sulfotransfer_3	1.2	21.1	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000052754	0.924	Decorin
2	9606.ENSP00000327336	0.920	Biglycan
3	9606.ENSP00000312506	0.917	Chondroitin sulfate proteoglycan 4
4	9606.ENSP00000265077	0.906	Versican core protein
5	9606.ENSP00000373244	0.905	Chondroitin sulfate proteoglycan 5
6	9606.ENSP00000252575	0.903	Neurocan core protein
7	9606.ENSP00000331210	0.901	Brevican core protein
8	9606.ENSP00000258214	0.782	Coiled-coil domain containing 102A
9	9606.ENSP00000353377	0.778	Coiled-coil domain containing 102B
10	9606.ENSP00000259750	0.725	Tau-tubulin kinase 1
11	9606.ENSP00000362480	0.697	Vacuolar protein sorting-associated protein 26A
12	9606.ENSP00000370719	0.689	Intersectin-1
13	9606.ENSP00000257663	0.684	Transmembrane protein 60
14	9606.ENSP00000280557	0.668	Density-regulated protein
15	9606.ENSP00000186436	0.641	Transmembrane protein 131
16	9606.ENSP00000376686	0.636	Lebercilin
17	9606.ENSP00000359353	0.629	Gamma-aminobutyric acid receptor subunit epsilon
18	9606.ENSP00000252032	0.610	Uncharacterized protein C20orf194
19	9606.ENSP00000362207	0.596	Carbohydrate sulfotransferase 3
20	9606.ENSP00000482657	0.591	Mitogen-activated protein kinase kinase kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047757	1.000	chondroitin-glucuronate 5-epimerase activity
GO:0016740	0.452	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008152	0.986	metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0044238	0.969	primary metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0009059	0.957	macromolecule biosynthetic process
GO:0030166	0.947	proteoglycan biosynthetic process
GO:0044272	0.923	sulfur compound biosynthetic process
GO:0005996	0.762	monosaccharide metabolic process
GO:0030203	0.736	glycosaminoglycan metabolic process
GO:0019752	0.729	carboxylic acid metabolic process
GO:0006023	0.725	aminoglycan biosynthetic process
GO:0032787	0.716	monocarboxylic acid metabolic process
GO:1903510	0.685	mucopolysaccharide metabolic process
GO:0006024	0.658	glycosaminoglycan biosynthetic process
GO:0016051	0.391	carbohydrate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.997	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21084	1.000	chondroitin 4'-sulfate = dermatan 4'-sulfate
EC:5.1.3.19	1.000	chondroitin-glucuronate 5-epimerase.
EC:2.-.-.-	0.452	Transferases.

[back to server]