StarFunc result for job id Q8IZX4

User Input

>input (1826 residues)
MRPGCDLLLRAAATVTAAIMSDSDSEEDSSGGGPFTLAGILFGNISGAGQLEGESVLDDE
CKKHLAGLGALGLGSLITELTANEELTGTGGALVNDEGWIRSTEDAVDYSDINEVAEDES
QRHQQTMGSLQPLYHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDAITCVSES
GEDIILPSIIAPSFLASEKVDFSSYSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDAT
KLLPSVTELFPEFRPGKVLRFLHLFGPGKNVPSVWRSARRKRKKHRELIQEEQIQEVECS
VESEVSQKSLWNYDYAPPPPPEQCLADDEITMMVPVESKFSQSTGDVDKVTDTKPRVAEW
RYGPARLWYDMLGVSEDGSGFDYGFKLRKTQHEPVIKSRMMEEFRKLEESNGTDLLADEN
FLMVTQLHWEDSIIWDGEDIKHKGTKPQGASLAGWLPSIKTRNVMAYNVQQGFAPTLDDD
KPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLALDPNDENLILEIPDEKEEAT
SNSPSKESKKESSLKKSRILLGKTGVIREEPQQNMSQPEVKDPWNLSNDEYYFPKQQGLR
GTFGGNIIQHSIPAMELWQPFFPTHMGPIKIRQFHRPPLKKYSFGALSQPGPHSVQPLLK
HIKKKAKMREQERQASGGGELFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIK
NYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQALENNLFRAPVYLHKMPETD
FLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSRRANMHIRDFLQVFIYRLFWKSKDR
PRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAKVS
PEQCCAYYSMIAAKQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVHAAPWNTTRAFIAA
MKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQAVKKTVTGTDADLRRLSLK
NAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQAHSGEGPMSKFARGSRFSVAEHQER
YKEECQRIFDLQNKVLSSTEVLSTDTDSISAEDSDFEEMGKNIENMLQNKKTSSQLSREW
EEQERKELRRMLLVAGSAASGNNHRDDVTASMTSLKSSATGHCLKIYRTFRDEEGKEYVR
CETVRKPAVIDAYVRIRTTKDEKFIQKFALFDEKHREEMRKERRRIQEQLRRLKRNQEKE
KLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNVPPSKPVAMTEEQEE
ELEKTVIHNDNEELIKVEGTKIVFGKQLIENVHEVRRKSLVLKFPKQQLPPKKKRRVGTT
VHCDYLNIPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTHPFHTPVNAKVVKDYYKII
TRPMDLQTLRENVRKCLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKL
KEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYY
KMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICY
QTITEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTSQPPDMYDTNTSLSTSRD
ASVFQDESNLSVLDISTATPEKQMCQGQGRLGEEDSDVDVEGYDDEEEDGKPKPPAPEGG
DGDLADEEEGTVQQPEASVLYEDLLISEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDV
GYGGIRPKQPFMLQHASGEHKDGHGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80UV9	0.434	0.421	0.000	1891	0.894	0.863	Q80UV9.pdb.gz	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
2	AFDB:Q8IZX4	1.000	1.000	0.000	1826	1.000	1.000	Q8IZX4.pdb.gz	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
3	PDB:7eghA	0.267	0.751	9.060E-82	630	0.333	0.965	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	PDB:7egbA	0.238	0.762	1.176E-72	558	0.294	0.961	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	PDB:6mzlA	0.219	0.848	2.201E-66	472	0.217	0.841	6mzlA.pdb.gz
6	AFDB:Q8LRK9	0.243	0.232	7.666E-56	1919	0.217	0.206	Q8LRK9.pdb.gz	TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana OX=3702 GN=TAF1 PE=1 SV=1
7	AFDB:P34333	0.038	0.039	2.936E-11	1778	0.112	0.115	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
8	AFDB:Q8I398	0.046	0.043	2.036E-8	2112	0.102	0.089	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
9	AFDB:P91620	0.046	0.041	6.813E-8	2061	0.126	0.112	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
10	AFDB:Q9VAW5	0.041	0.044	4.909E-6	1673	0.123	0.134	Q9VAW5.pdb.gz	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
11	AFDB:A8DZ29	0.047	0.045	1.485E-5	1919	0.122	0.116	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
12	AFDB:Q8I3S3	0.045	0.043	2.112E-5	1894	0.094	0.090	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
13	AFDB:Q9UIF9	0.070	0.067	2.583E-5	1905	0.131	0.126	Q9UIF9.pdb.gz	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
14	PDB:5svag	0.034	0.327	1.421E-3	172	0.009	0.099	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
15	PDB:3javA	0.040	0.035	4.576E-2	2327	0.088	0.069	3javA.pdb.gz
16	PDB:6gylQ	0.038	0.364	5.596E-2	148	0.007	0.088	6gylQ.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
17	PDB:6o9lT	0.030	0.218	7.959E-2	237	0.015	0.114	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:6s1cB	0.032	0.124	1.872E-1	342	0.023	0.123	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
19	PDB:5okcB	0.032	0.129	2.801E-1	377	0.020	0.095	5okcB.pdb.gz	Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
20	PDB:3cuqA	0.031	0.206	3.788E-1	219	0.010	0.082	3cuqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7M0	0.0	3114	1893	0.893	0.861	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
2	A0A8I6A7N8	0.0	3043	1837	0.872	0.867	A0A8I6A7N8_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
3	G5EGM3	0.0	800	1744	0.268	0.281	TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans OX=6239 GN=taf-1 PE=2 SV=1
4	P21675	0.0	3169	1872	0.917	0.895	TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1 PE=1 SV=3
5	P51123	0.0	1548	2129	0.473	0.406	TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster OX=7227 GN=Taf1 PE=1 SV=3
6	Q1LYC2	0.0	2572	1947	0.754	0.707	Q1LYC2_DANRE Transcription initiation factor TFIID subunit OS=Danio rerio OX=7955 GN=wu:fi04f03 PE=1 SV=1
7	Q60544	0.0	3091	1865	0.886	0.867	TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus OX=10036 GN=TAF1 PE=2 SV=1
8	Q80UV9	0.0	3095	1891	0.892	0.861	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
9	Q8IZX4	0.0	3795	1826	1.000	1.000	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
10	Q09813	1.53e-59	226	979	0.092	0.172	T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2G11.14 PE=1 SV=1
11	P46677	1.04e-56	218	1066	0.085	0.146	TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF1 PE=1 SV=1
12	Q86U86	2.59e-13	78.2	1689	0.032	0.035	PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
13	A0A8I5ZMW9	3.03e-13	78.2	1704	0.032	0.034	A0A8I5ZMW9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
14	E7EVG2	3.35e-13	77.8	1460	0.032	0.040	E7EVG2_HUMAN Polybromo 1 (Fragment) OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=8
15	D3ZT52	3.41e-13	77.8	1652	0.032	0.035	D3ZT52_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=3
16	F1RCN2	3.90e-13	77.8	1502	0.020	0.024	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
17	E9Q2Z1	3.93e-13	77.8	1453	0.019	0.024	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
18	A0A8I6AV81	4.30e-13	77.4	1624	0.032	0.036	A0A8I6AV81_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
19	A0A8I6AR61	4.41e-13	77.4	1634	0.032	0.035	A0A8I6AR61_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
20	A0A8I6G5U9	4.61e-13	77.4	1587	0.032	0.037	A0A8I6G5U9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	4.5e-37	137.3	Bromodomain
2	PF12157 DUF3591	6.1e-163	554.3	Protein of unknown function (DUF3591)
3	PF09247 TBP-binding	9.2e-17	72.4	TATA box-binding protein binding
4	PF15288 zf-CCHC_6	1e-13	62.2	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
2	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
3	9606.ENSP00000375942	0.999	TATA-box-binding protein
4	9606.ENSP00000399982	0.998	Transcription initiation factor TFIID subunit 6
5	9606.ENSP00000358854	0.994	Transcription initiation factor TFIID subunit 5
6	9606.ENSP00000252996	0.988	Transcription initiation factor TFIID subunit 4
7	9606.ENSP00000339917	0.988	Transcription initiation factor TFIID subunit 9B
8	9606.ENSP00000263974	0.982	Transcription initiation factor TFIID subunit 12
9	9606.ENSP00000340271	0.981	Transcription initiation factor TFIID subunit 3
10	9606.ENSP00000354633	0.979	Transcription initiation factor TFIID subunit 11
11	9606.ENSP00000370193	0.976	Transcription initiation factor TFIID subunit 9
12	9606.ENSP00000355051	0.975	Transcription initiation factor TFIID subunit 13
13	9606.ENSP00000359531	0.974	Transcription initiation factor IIB
14	9606.ENSP00000377969	0.965	General transcription factor IIF subunit 1
15	9606.ENSP00000299424	0.956	Transcription initiation factor TFIID subunit 10
16	9606.ENSP00000362068	0.947	Transcription initiation factor TFIID subunit 8
17	9606.ENSP00000247219	0.946	TATA box-binding protein-like protein 2
18	9606.ENSP00000269305	0.942	Cellular tumor antigen p53
19	9606.ENSP00000258281	0.931	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
20	9606.ENSP00000361998	0.911	Transcription initiation factor TFIID subunit 7-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140296	0.999	general transcription initiation factor binding
GO:0140223	0.998	general transcription initiation factor activity
GO:0003677	0.998	DNA binding
GO:0070577	0.997	lysine-acetylated histone binding
GO:0004402	0.995	histone acetyltransferase activity
GO:0017025	0.993	TBP-class protein binding
GO:0016251	0.781	RNA polymerase II general transcription initiation factor activity
GO:0003682	0.684	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0019222	0.945	regulation of metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0031323	0.943	regulation of cellular metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0010468	0.930	regulation of gene expression
GO:0019219	0.925	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.917	positive regulation of biological process
GO:0009889	0.917	regulation of biosynthetic process
GO:0051252	0.917	regulation of RNA metabolic process
GO:0006355	0.913	regulation of DNA-templated transcription
GO:0048522	0.911	positive regulation of cellular process
GO:0009893	0.899	positive regulation of metabolic process
GO:0010604	0.891	positive regulation of macromolecule metabolic process
GO:0006357	0.880	regulation of transcription by RNA polymerase II
GO:0051173	0.875	positive regulation of nitrogen compound metabolic process
GO:0045935	0.870	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.863	positive regulation of DNA-templated transcription
GO:0032501	0.857	multicellular organismal process
GO:0071704	0.837	organic substance metabolic process
GO:0043170	0.784	macromolecule metabolic process
GO:0044238	0.779	primary metabolic process
GO:0006807	0.757	nitrogen compound metabolic process
GO:0071840	0.732	cellular component organization or biogenesis
GO:0016043	0.703	cellular component organization
GO:0044237	0.585	cellular metabolic process
GO:0050896	0.466	response to stimulus
GO:0045944	0.374	positive regulation of transcription by RNA polymerase II
GO:0090304	0.366	nucleic acid metabolic process
GO:0010467	0.328	gene expression
GO:0032774	0.327	RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.991	nucleoplasm
GO:0032991	0.739	protein-containing complex
GO:1902494	0.458	catalytic complex
GO:0140513	0.453	nuclear protein-containing complex
GO:0043228	0.425	non-membrane-bounded organelle
GO:0043232	0.424	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	0.995	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.995	histone acetyltransferase.

[back to server]