StarFunc result for job id Q8IZY2

User Input

>input (2146 residues)
MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKP
LPSAGTVPWLQGLICNVNNTCFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGASAHR
TLAGLGKLIATLRAARSTAQPQPTKQSPLEPPMLDVAELLTSLLRTESLGLALGQAQEPL
HSLLEAAEDLAQELLALRSLVELRALLQRPRGTSGPLELLSEALCSVRGPSSTVGPSLNW
YEASDLMELVGQEPESALPDSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLLFAPD
TPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR
QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAA
LVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR
DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRAGLYLQQMPYPCYVDD
VFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCL
GPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACG
GLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVG
TRPTADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPP
KSPAPCPTPLDPKVLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFL
GHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDE
HVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV
VILDEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCG
SPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLA
LVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE
EIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETD
QGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIV
PPFGHYPALRLSPTMYGAQVSFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSA
PEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQ
NLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELW
ALLSPLPGGALDRVLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLP
PGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEE
RVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALL
LLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQKLQEV
SRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQ
GPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTK
VYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAR
EPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYAD
RPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVML
TSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAA
EFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYF
SKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5xjyA	0.702	0.788	0.000	1901	0.452	0.510	5xjyA.pdb.gz
2	PDB:7e7iA	0.814	0.866	0.000	2011	0.448	0.478	7e7iA.pdb.gz
3	PDB:7e7qA	0.660	0.713	0.000	1958	0.444	0.486	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
4	PDB:7lkzA	0.682	0.750	0.000	1920	0.448	0.501	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
5	PDB:7m1pA	0.786	0.865	0.000	1938	0.436	0.482	7m1pA.pdb.gz
6	PDB:7m1qA	0.765	0.856	0.000	1911	0.415	0.466	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.
7	PDB:7roqA	0.742	0.864	0.000	1831	0.452	0.529	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
8	PDB:7tbwA	0.691	0.759	0.000	1928	0.501	0.558	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
9	PDB:7tbyA	0.784	0.937	0.000	1788	0.481	0.578	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
10	AFDB:A0A0G2K1Q8	0.592	0.733	0.000	1704	0.271	0.341	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
11	AFDB:B8A446	0.900	0.853	0.000	2268	0.527	0.499	B8A446.pdb.gz	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
12	AFDB:E9PWH4	0.599	0.756	0.000	1668	0.232	0.299	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
13	AFDB:E9PX95	0.624	0.761	0.000	1733	0.257	0.318	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
14	AFDB:E9Q876	0.754	0.630	0.000	2595	0.333	0.276	E9Q876.pdb.gz	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
15	AFDB:O35600	0.888	0.826	0.000	2310	0.470	0.437	O35600.pdb.gz	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
16	AFDB:O95477	0.790	0.754	0.000	2261	0.528	0.502	O95477.pdb.gz	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
17	AFDB:P78363	0.879	0.832	0.000	2273	0.468	0.442	P78363.pdb.gz	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
18	AFDB:Q7TNJ2	0.948	0.938	0.000	2170	0.780	0.771	Q7TNJ2.pdb.gz	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
19	AFDB:Q86UK0	0.758	0.634	0.000	2595	0.329	0.272	Q86UK0.pdb.gz	ABCAC_HUMAN Glucosylceramide transporter ABCA12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3
20	PDB:7w01A	0.611	0.808	9.326E-100	1598	0.268	0.360	7w01A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WXK5	655	2466	0.190	0.165	A0A087WXK5_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=1
2	A0A8I5ZLK5	2095	2263	0.494	0.469	A0A8I5ZLK5_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
3	A0A8I6ATT1	2080	2190	0.490	0.480	A0A8I6ATT1_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
4	B2RY11	1093	2595	0.322	0.267	B2RY11_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
5	B2RY21	1095	2595	0.323	0.267	B2RY21_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
6	B8A446	2105	2268	0.495	0.468	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
7	E9Q876	1096	2595	0.323	0.267	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
8	F1LNL3	2104	2201	0.493	0.481	F1LNL3_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=4
9	F1MWM0	1791	2281	0.436	0.410	ABCA4_BOVIN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Bos taurus OX=9913 GN=ABCA4 PE=1 SV=2
10	K9J4V5	2116	2262	0.487	0.462	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1
11	O35600	1788	2310	0.440	0.409	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
12	O95477	2098	2261	0.487	0.463	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
13	P41233	2094	2261	0.493	0.468	ABCA1_MOUSE Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4
14	P41234	694	2434	0.174	0.153	ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus OX=10090 GN=Abca2 PE=1 SV=4
15	P78363	1761	2273	0.439	0.414	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
16	Q5SSE9	988	5034	0.325	0.138	ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus OX=10090 GN=Abca13 PE=1 SV=1
17	Q7TNJ2	3252	2170	0.784	0.775	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
18	Q80ZB2	2090	2201	0.490	0.478	Q80ZB2_RAT ATP-binding cassette 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=2 SV=1
19	Q86UK0	1065	2595	0.320	0.264	ABCAC_HUMAN Glucosylceramide transporter ABCA12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3
20	Q86UQ4	999	5058	0.318	0.135	ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens OX=9606 GN=ABCA13 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	21	16.2	AAA ATPase domain
2	PF13304 AAA_21	2.4e-17	75.3	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	6.4	18.8	AAA domain
4	PF12698 ABC2_membrane_3	4.7e-57	205.3	ABC-2 family transporter protein
5	PF00005 ABC_tran	2.5e-42	156.1	ABC transporter
6	PF13732 DUF4162	14	17.8	Domain of unknown function (DUF4162)
7	PF13558 SbcC_Walker_B	4e+02	12.7	SbcC/RAD50-like, Walker B motif
8	PF00448 SRP54	65	14.6	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263094

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236850	0.956	Apolipoprotein A-I
2	9606.ENSP00000252486	0.862	Apolipoprotein E
3	9606.ENSP00000316779	0.860	Myc box-dependent-interacting protein 1
4	9606.ENSP00000377015	0.860	Phosphatidylinositol-binding clathrin assembly protein
5	9606.ENSP00000352264	0.843	CD2-associated protein
6	9606.ENSP00000392770	0.834	Membrane-spanning 4-domains subfamily A member 6A
7	9606.ENSP00000315130	0.811	Clusterin
8	9606.ENSP00000260197	0.807	Sortilin-related receptor
9	9606.ENSP00000275815	0.779	Ephrin type-A receptor 1
10	9606.ENSP00000262262	0.758	Myeloid cell surface antigen CD33
11	9606.ENSP00000381109	0.755	Zinc finger CW-type and PWWP domain containing 1
12	9606.ENSP00000362205	0.744	Triggering receptor expressed on myeloid cells 2
13	9606.ENSP00000300182	0.738	Membrane-spanning 4-domains subfamily A member 6E
14	9606.ENSP00000296149	0.737	Elongator complex protein 6
15	9606.ENSP00000199447	0.726	Thioredoxin domain-containing protein 3
16	9606.ENSP00000353462	0.717	Cas scaffolding protein family member 4
17	9606.ENSP00000431840	0.713	Sodium/potassium/calcium exchanger 4
18	9606.ENSP00000338648	0.709	Membrane-spanning 4-domains subfamily A member 4A
19	9606.ENSP00000216487	0.695	Ras and Rab interactor 3
20	9606.ENSP00000355747	0.694	Presenilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0038024	0.988	cargo receptor activity
GO:0005548	0.988	phospholipid transporter activity
GO:0004888	0.987	transmembrane signaling receptor activity
GO:0005488	0.986	binding
GO:0140326	0.986	ATPase-coupled intramembrane lipid transporter activity
GO:0008525	0.961	phosphatidylcholine transporter activity
GO:0005515	0.958	protein binding
GO:0022857	0.939	transmembrane transporter activity
GO:0042626	0.909	ATPase-coupled transmembrane transporter activity
GO:0097367	0.744	carbohydrate derivative binding
GO:0097159	0.724	organic cyclic compound binding
GO:0008289	0.721	lipid binding
GO:0043167	0.709	ion binding
GO:0044877	0.704	protein-containing complex binding
GO:0036094	0.703	small molecule binding
GO:0043168	0.695	anion binding
GO:1901363	0.692	heterocyclic compound binding
GO:0005524	0.653	ATP binding
GO:0140327	0.478	flippase activity
GO:0140333	0.449	glycerophospholipid flippase activity
GO:0140328	0.434	floppase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.995	regulation of biological process
GO:1902991	0.987	regulation of amyloid precursor protein catabolic process
GO:0051179	0.985	localization
GO:0050794	0.984	regulation of cellular process
GO:0033036	0.983	macromolecule localization
GO:0071702	0.983	organic substance transport
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0015918	0.968	sterol transport
GO:0050896	0.964	response to stimulus
GO:0030301	0.958	cholesterol transport
GO:0043170	0.957	macromolecule metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:1901564	0.943	organonitrogen compound metabolic process
GO:0015748	0.939	organophosphate ester transport
GO:0044238	0.931	primary metabolic process
GO:0032501	0.929	multicellular organismal process
GO:0015914	0.926	phospholipid transport
GO:0061024	0.920	membrane organization
GO:0048518	0.810	positive regulation of biological process
GO:0065008	0.743	regulation of biological quality
GO:0051716	0.701	cellular response to stimulus
GO:0019538	0.700	protein metabolic process
GO:0048519	0.693	negative regulation of biological process
GO:0044085	0.679	cellular component biogenesis
GO:0097035	0.656	regulation of membrane lipid distribution
GO:0044237	0.646	cellular metabolic process
GO:0048522	0.624	positive regulation of cellular process
GO:0051049	0.515	regulation of transport
GO:0043933	0.502	protein-containing complex organization
GO:0022607	0.497	cellular component assembly
GO:0023052	0.479	signaling
GO:0007154	0.479	cell communication
GO:0048523	0.478	negative regulation of cellular process
GO:0031323	0.467	regulation of cellular metabolic process
GO:0051128	0.464	regulation of cellular component organization
GO:0007165	0.453	signal transduction
GO:0048583	0.399	regulation of response to stimulus
GO:0009892	0.384	negative regulation of metabolic process
GO:0010605	0.357	negative regulation of macromolecule metabolic process
GO:1902003	0.344	regulation of amyloid-beta formation
GO:0065003	0.313	protein-containing complex assembly
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.981	endomembrane system
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005737	0.963	cytoplasm
GO:0030054	0.325	cell junction
GO:0005794	0.319	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	0.986	P-type phospholipid transporter.
EC:7.-.-.-	0.909	Translocases.

[back to server]