StarFunc result for job id Q8J025

User Input

>input (514 residues)
MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLH
NGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTY
TLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGP
WVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDAT
QRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRC
EVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGT
EFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHT
EYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDS
GSSLYGRAPGRHTWSLLLAALACLVPLLHWNIRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U128	0.867	0.867	8.035E-94	514	0.918	0.918	Q3U128.pdb.gz	APCD1_MOUSE Protein APCDD1 OS=Mus musculus OX=10090 GN=Apcdd1 PE=1 SV=1
2	AFDB:Q5R2J4	0.862	0.860	1.166E-91	515	0.864	0.862	Q5R2J4.pdb.gz	APCD1_PELSI Protein APCDD1 OS=Pelodiscus sinensis OX=13735 GN=APCDD1 PE=2 SV=1
3	AFDB:Q5R2I8	0.884	0.883	1.781E-91	515	0.846	0.845	Q5R2I8.pdb.gz	APCD1_CHICK Protein APCDD1 OS=Gallus gallus OX=9031 GN=APCDD1 PE=2 SV=1
4	AFDB:Q66KI8	0.818	0.817	8.327E-81	515	0.726	0.724	Q66KI8.pdb.gz	APCD1_XENLA Protein APCDD1 OS=Xenopus laevis OX=8355 GN=apcdd1 PE=2 SV=1
5	AFDB:Q8NCL9	0.804	0.824	5.118E-58	501	0.447	0.459	Q8NCL9.pdb.gz	APCDL_HUMAN Protein APCDD1-like OS=Homo sapiens OX=9606 GN=APCDD1L PE=1 SV=1
6	AFDB:B1WC72	0.119	0.099	1.415E-4	677	0.109	0.083	B1WC72.pdb.gz	B1WC72_RAT Rpgr protein OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
7	AFDB:Q9R0X5	0.099	0.068	7.702E-4	1001	0.107	0.055	Q9R0X5.pdb.gz	RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2
8	AFDB:Q92834	0.121	0.076	1.379E-3	1020	0.103	0.052	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
9	AFDB:Q80YD6	0.116	0.123	1.895E-3	464	0.107	0.119	Q80YD6.pdb.gz	SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus OX=10090 GN=Sergef PE=2 SV=2
10	PDB:5xgsA	0.136	0.160	4.270E-3	398	0.072	0.093	5xgsA.pdb.gz
11	PDB:4o9yA	0.093	0.033	6.523E-3	2490	0.076	0.016	4o9yA.pdb.gz
12	PDB:8gqeB	0.108	0.133	8.061E-3	386	0.086	0.114	8gqeB.pdb.gz
13	PDB:5t94A	0.105	0.112	9.963E-3	454	0.093	0.106	5t94A.pdb.gz
14	PDB:3fyxA	0.102	0.132	1.050E-2	340	0.068	0.103	3fyxA.pdb.gz	On the function and structure of synthetically modified porins.
15	PDB:7e4hA	0.149	0.166	1.784E-2	439	0.089	0.105	7e4hA.pdb.gz
16	PDB:2xe4A	0.106	0.087	2.091E-2	721	0.062	0.044	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
17	PDB:3wjeB	0.113	0.242	2.324E-2	154	0.051	0.169	3wjeB.pdb.gz
18	AFDB:P25171	0.106	0.103	2.675E-2	547	0.099	0.093	P25171.pdb.gz	RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster OX=7227 GN=Rcc1 PE=1 SV=2
19	PDB:2j1nA	0.129	0.168	4.162E-2	346	0.072	0.107	2j1nA.pdb.gz	Crystal Structure of Osmoporin Ompc from E. Coli at 2.0 A.
20	PDB:3sybA	0.100	0.113	4.388E-2	408	0.070	0.088	3sybA.pdb.gz	Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U128	0.0	983	514	0.918	0.918	APCD1_MOUSE Protein APCDD1 OS=Mus musculus OX=10090 GN=Apcdd1 PE=1 SV=1
2	Q5R2I8	0.0	932	515	0.846	0.845	APCD1_CHICK Protein APCDD1 OS=Gallus gallus OX=9031 GN=APCDD1 PE=2 SV=1
3	Q5R2J4	0.0	915	515	0.864	0.862	APCD1_PELSI Protein APCDD1 OS=Pelodiscus sinensis OX=13735 GN=APCDD1 PE=2 SV=1
4	Q66KI8	0.0	796	515	0.745	0.744	APCD1_XENLA Protein APCDD1 OS=Xenopus laevis OX=8355 GN=apcdd1 PE=2 SV=1
5	Q8J025	0.0	1080	514	1.000	1.000	APCD1_HUMAN Protein APCDD1 OS=Homo sapiens OX=9606 GN=APCDD1 PE=1 SV=1
6	Q8NCL9	8.26e-145	427	501	0.440	0.451	APCDL_HUMAN Protein APCDD1-like OS=Homo sapiens OX=9606 GN=APCDD1L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14921 APCDDC	2.3e-128	438.2	Adenomatosis polyposis coli down-regulated 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284523	0.767	Protein Wnt-3a
2	9606.ENSP00000384690	0.640	Monocyte to macrophage differentiation associated 2
3	9606.ENSP00000294304	0.551	Low-density lipoprotein receptor-related protein 5
4	9606.ENSP00000361411	0.551	Zinc finger CCHC-type containing 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048856	0.990	anatomical structure development
GO:0048523	0.986	negative regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0009966	0.984	regulation of signal transduction
GO:0032501	0.970	multicellular organismal process
GO:0030111	0.967	regulation of Wnt signaling pathway
GO:0030178	0.952	negative regulation of Wnt signaling pathway
GO:0050793	0.821	regulation of developmental process
GO:0009987	0.816	cellular process
GO:0009888	0.747	tissue development
GO:0048513	0.702	animal organ development
GO:0007275	0.579	multicellular organism development
GO:0008544	0.480	epidermis development
GO:0048731	0.468	system development
GO:0048518	0.346	positive regulation of biological process
GO:0022603	0.321	regulation of anatomical structure morphogenesis
GO:0048522	0.321	positive regulation of cellular process
GO:0030154	0.319	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005886	0.994	plasma membrane
GO:0005576	0.990	extracellular region
GO:0005615	0.974	extracellular space
GO:0043227	0.833	membrane-bounded organelle
GO:0005622	0.811	intracellular anatomical structure
GO:0005737	0.743	cytoplasm
GO:0043231	0.739	intracellular membrane-bounded organelle
GO:0012505	0.567	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]