StarFunc result for job id Q8N0V5

User Input

>input (402 residues)
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYP
TENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMP
QNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVAS
EVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHK
NSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHF
WVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNS
PSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N0V5	1.000	1.000	4.325E-83	402	1.000	1.000	Q8N0V5.pdb.gz	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
2	AFDB:Q6T5E1	0.890	0.894	4.137E-67	400	0.756	0.760	Q6T5E1.pdb.gz	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
3	AFDB:P97402	0.888	0.890	3.776E-65	401	0.687	0.688	P97402.pdb.gz	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
4	AFDB:Q6T5D9	0.878	0.883	2.590E-63	400	0.677	0.680	Q6T5D9.pdb.gz	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
5	AFDB:O95395	0.759	0.698	1.995E-41	438	0.363	0.333	O95395.pdb.gz	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
6	AFDB:Q5JCT0	0.754	0.695	3.532E-41	437	0.383	0.352	Q5JCT0.pdb.gz	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
7	AFDB:E9Q649	0.784	0.696	8.663E-40	455	0.358	0.316	E9Q649.pdb.gz	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
8	AFDB:Q09324	0.778	0.732	1.221E-39	428	0.338	0.318	Q09324.pdb.gz	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
9	AFDB:Q9P109	0.794	0.707	6.045E-39	453	0.351	0.311	Q9P109.pdb.gz	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
10	AFDB:Q02742	0.775	0.730	9.017E-39	428	0.356	0.334	Q02742.pdb.gz	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
11	PDB:2gamC	0.780	0.837	1.404E-36	374	0.336	0.361	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
12	PDB:6fxrA	0.267	0.165	3.870E-5	700	0.072	0.041	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:3r2wC	0.241	0.219	1.360E-4	450	0.060	0.053	3r2wC.pdb.gz
14	PDB:7jhiC	0.390	0.457	1.360E-4	331	0.085	0.103	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
15	PDB:3okrC	0.227	0.417	2.409E-4	194	0.070	0.144	3okrC.pdb.gz	Crystal Structure of the Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): an antitubercular drug target
16	PDB:7x8kB	0.232	0.249	3.393E-4	367	0.050	0.054	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
17	PDB:5a07A	0.201	0.204	5.675E-4	395	0.077	0.078	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
18	PDB:2i5kB	0.239	0.211	9.491E-4	466	0.060	0.052	2i5kB.pdb.gz
19	PDB:2d7iA	0.274	0.211	1.499E-3	536	0.070	0.052	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
20	PDB:3gueA	0.227	0.200	1.779E-3	468	0.087	0.075	3gueA.pdb.gz	Crystal Structure of UDP-glucose phosphorylase from Trypanosoma Brucei, (Tb10.389.0330)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97402	0.0	592	401	0.679	0.681	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
2	Q6T5D9	0.0	570	400	0.667	0.670	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
3	Q6T5E0	0.0	579	400	0.664	0.667	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
4	Q6T5E1	0.0	660	400	0.756	0.760	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
5	Q8N0V5	0.0	845	402	1.000	1.000	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
6	Q5JCT0	1.96e-98	302	437	0.398	0.366	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
7	Q8CH87	1.78e-96	297	437	0.368	0.339	GCNT3_RAT Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1
8	E9Q649	1.87e-94	292	455	0.366	0.323	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
9	O95395	2.07e-94	291	438	0.361	0.331	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
10	Q9P109	7.04e-93	288	453	0.351	0.311	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
11	Q02742	7.85e-89	277	428	0.353	0.332	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
12	Q64165	2.04e-86	271	428	0.336	0.315	Q64165_RAT Glucosaminyl (N-acetyl) transferase 1 OS=Rattus norvegicus OX=10116 GN=Gcnt1 PE=4 SV=1
13	Q09324	2.10e-86	271	428	0.333	0.313	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
14	Q7KVA1	4.98e-23	103	876	0.231	0.106	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
15	Q9EPL0	8.39e-18	87.8	865	0.199	0.092	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
16	D3J0E7	1.06e-16	84.7	919	0.189	0.083	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
17	Q9H1B5	2.11e-16	83.6	865	0.192	0.089	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
18	Q811B1	1.45e-14	78.2	953	0.172	0.072	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
19	Q9EPI1	6.93e-14	75.9	821	0.172	0.084	XYLT1_RAT Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
20	Q86Y38	3.81e-13	73.6	959	0.167	0.070	XYLT1_HUMAN Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	1.1e-61	220.1	Core-2/I-Branching enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305595	0.955	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
2	9606.ENSP00000321874	0.954	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
3	9606.ENSP00000369055	0.950	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000312021	0.948	Galactoside 2-alpha-L-fucosyltransferase 1
5	9606.ENSP00000420161	0.945	Beta-1,4-galactosyltransferase 4
6	9606.ENSP00000480884	0.943	Type 2 lactosamine alpha-2,3-sialyltransferase
7	9606.ENSP00000305603	0.940	Galactoside 3(4)-L-fucosyltransferase
8	9606.ENSP00000387498	0.933	Galactoside 2-alpha-L-fucosyltransferase 2
9	9606.ENSP00000351602	0.923	Alpha-(1,3)-fucosyltransferase 4
10	9606.ENSP00000313398	0.921	Alpha-(1,3)-fucosyltransferase 6
11	9606.ENSP00000302599	0.916	Alpha-(1,3)-fucosyltransferase 9
12	9606.ENSP00000480428	0.914	Beta-1,4-galactosyltransferase 3
13	9606.ENSP00000466880	0.904	Alpha-(1,3)-fucosyltransferase 5
14	9606.ENSP00000251607	0.820	CCA tRNA nucleotidyltransferase 1, mitochondrial
15	9606.ENSP00000369400	0.815	Nance-Horan syndrome protein
16	9606.ENSP00000264009	0.725	Heat shock factor protein 4
17	9606.ENSP00000417581	0.716	Protein FAM199X
18	9606.ENSP00000221973	0.696	Lens intrinsic membrane protein 2
19	9606.ENSP00000284690	0.692	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
20	9606.ENSP00000357682	0.674	Fibronectin type 3 and ankyrin repeat domains protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005515	0.991	protein binding
GO:0140096	0.780	catalytic activity, acting on a protein
GO:0008109	0.563	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity
GO:0140103	0.467	catalytic activity, acting on a glycoprotein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0044238	0.977	primary metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0050794	0.927	regulation of cellular process
GO:1901564	0.919	organonitrogen compound metabolic process
GO:0043170	0.883	macromolecule metabolic process
GO:1901135	0.868	carbohydrate derivative metabolic process
GO:1901137	0.862	carbohydrate derivative biosynthetic process
GO:0044249	0.857	cellular biosynthetic process
GO:1901566	0.854	organonitrogen compound biosynthetic process
GO:0009059	0.851	macromolecule biosynthetic process
GO:0070085	0.796	glycosylation
GO:0019538	0.788	protein metabolic process
GO:0009101	0.770	glycoprotein biosynthetic process
GO:0006486	0.760	protein glycosylation
GO:0032501	0.403	multicellular organismal process
GO:0050896	0.392	response to stimulus
GO:0048518	0.338	positive regulation of biological process
GO:0048522	0.303	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.996	endomembrane system
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0005737	0.972	cytoplasm
GO:0000139	0.886	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:17413	0.563	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.150	0.563	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase.

[back to server]