StarFunc result for job id Q8N0W3

User Input

>input (1084 residues)
MEQPKGVDWTVIILTCQYKDSVQVFQRELEVRQKREQIPAGTLLLAVEDPEKRVGSGGAT
LNALLVAAEHLSARAGFTVVTSDVLHSAWILILHMGRDFPFDDCGRAFTCLPVENPEAPV
EALVCNLDCLLDIMTYRLGPGSPPGVWVCSTDMLLSVPANPGISWDSFRGARVIALPGSP
AYAQNHGVYLTDPQGLVLDIYYQGTEAEIQRCVRPDGRVPLVSGVVFFSVETAERLLATH
VSPPLDACTYLGLDSGARPVQLSLFFDILHCMAENVTREDFLVGRPPELGQGDADVAGYL
QSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQVEEQQL
LAAGSSVVSCLLEGPVQLGPGSVLQHCHLQGPIHIGAGCLVTGLDTAHSKALHGRELRDL
VLQGHHTRLHGSPGHAFTLVGRLDSWERQGAGTYLNVPWSEFFKRTGVRAWDLWDPETLP
AEYCLPSARLFPVLHPSRELGPQDLLWMLDHQEDGGEALRAWRASWRLSWEQLQPCLDRA
ATLASRRDLFFRQALHKARHVLEARQDLSLRPLIWAAVREGCPGPLLATLDQVAAGAGDP
GVAARALACVADVLGCMAEGRGGLRSGPAANPEWMRPFSYLECGDLAAGVEALAQERDKW
LSRPALLVRAARHYEGAGQILIRQAVMSAQHFVSTEQVELPGPGQWVVAECPARVDFSGG
WSDTPPLAYELGGAVLGLAVRVDGRRPIGARARRIPEPELWLAVGPRQDEMTVKIVCRCL
ADLRDYCQPHAPGALLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGL
GTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRS
RAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNA
HSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQS
LAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTC
CPFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JVI4	0.991	0.986	0.000	1090	0.853	0.849	A0A0G2JVI4.pdb.gz	A0A0G2JVI4_RAT Fucose kinase OS=Rattus norvegicus OX=10116 GN=Fcsk PE=1 SV=1
2	AFDB:Q8N0W3	1.000	1.000	0.000	1084	1.000	1.000	Q8N0W3.pdb.gz	FCSK_HUMAN L-fucose kinase OS=Homo sapiens OX=9606 GN=FCSK PE=1 SV=2
3	AFDB:Q9LNJ9	0.571	0.583	5.731E-60	1055	0.229	0.235	Q9LNJ9.pdb.gz	FKGP_ARATH Bifunctional fucokinase/fucose pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=FKGP PE=1 SV=2
4	AFDB:Q4QEX2	0.472	0.440	2.112E-48	1187	0.215	0.196	Q4QEX2.pdb.gz	Q4QEX2_LEIMA Putative fucose kinase OS=Leishmania major OX=5664 GN=LMJF_16_0480 PE=4 SV=1
5	AFDB:G5E8F4	0.405	0.712	4.338E-26	590	0.101	0.186	G5E8F4.pdb.gz	FPGT_MOUSE Fucose-1-phosphate guanylyltransferase OS=Mus musculus OX=10090 GN=Fpgt PE=1 SV=1
6	AFDB:O14772	0.406	0.694	1.226E-25	607	0.094	0.168	O14772.pdb.gz	FPGT_HUMAN Fucose-1-phosphate guanylyltransferase OS=Homo sapiens OX=9606 GN=FPGT PE=1 SV=3
7	AFDB:Q97EQ3	0.287	0.820	5.043E-21	364	0.078	0.234	Q97EQ3.pdb.gz	Q97EQ3_CLOAB Sugar kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C3055 PE=4 SV=1
8	AFDB:Q0P8I9	0.288	0.876	1.761E-18	339	0.058	0.186	Q0P8I9.pdb.gz	HDDA_CAMJE D-glycero-alpha-D-manno-heptose 7-phosphate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=hddA PE=1 SV=1
9	PDB:4n3oA	0.244	0.726	8.225E-14	328	0.059	0.195	4n3oA.pdb.gz	2.4 Angstrom Resolution Crystal Structure of Putative Sugar Kinase from Campylobacter jejuni.
10	AFDB:Q9SEE5	0.247	0.506	4.358E-13	496	0.065	0.143	Q9SEE5.pdb.gz	GALK1_ARATH Galactokinase OS=Arabidopsis thaliana OX=3702 GN=GAL1 PE=1 SV=2
11	AFDB:Q9HDU2	0.257	0.503	1.121E-12	519	0.060	0.125	Q9HDU2.pdb.gz	GAL1_SCHPO Galactokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gal1 PE=3 SV=1
12	PDB:6q3xA	0.256	0.643	2.584E-12	393	0.058	0.160	6q3xA.pdb.gz	Fragment Screening Reveals Starting Points for Rational Design of Galactokinase 1 Inhibitors to Treat Classic Galactosemia.
13	PDB:1s4eF	0.250	0.702	9.693E-12	351	0.058	0.179	1s4eF.pdb.gz	Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
14	PDB:2aj4A	0.254	0.509	2.163E-11	509	0.057	0.122	2aj4A.pdb.gz	Molecular structure of Saccharomyces cerevisiae Gal1p, a bifunctional galactokinase and transcriptional inducer
15	PDB:6q91D	0.231	0.613	3.636E-11	360	0.056	0.169	6q91D.pdb.gz	Structure of human galactokinase 1 bound with 5-Chloro-N-isobutyl-2-methoxybenzamide
16	PDB:3v2uC	0.250	0.491	9.350E-11	516	0.061	0.128	3v2uC.pdb.gz	The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.
17	PDB:2r42A	0.249	0.625	2.293E-10	383	0.064	0.180	2r42A.pdb.gz	Biochemical and Structural Basis for Feedback Inhibition of Mevalonate Kinase and Isoprenoid Metabolism.
18	PDB:2a2dA	0.265	0.596	5.366E-10	448	0.067	0.163	2a2dA.pdb.gz	The molecular architecture of human N-acetylgalactosamine kinase.
19	PDB:2r3vA	0.244	0.590	9.914E-10	390	0.065	0.182	2r3vA.pdb.gz
20	PDB:4rksB	0.222	0.609	1.051E-8	320	0.037	0.125	4rksB.pdb.gz	Structural analysis of mevalonate-3-kinase provides insight into the mechanisms of isoprenoid pathway decarboxylases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVI4	0.0	1830	1090	0.852	0.848	A0A0G2JVI4_RAT Fucose kinase OS=Rattus norvegicus OX=10116 GN=Fcsk PE=1 SV=1
2	D3ZDZ7	0.0	1578	1018	0.735	0.783	D3ZDZ7_RAT Fucose kinase OS=Rattus norvegicus OX=10116 GN=Fcsk PE=4 SV=2
3	Q7TMC8	0.0	1842	1090	0.855	0.850	FCSK_MOUSE L-fucose kinase OS=Mus musculus OX=10090 GN=Fcsk PE=1 SV=1
4	Q8N0W3	0.0	2187	1084	1.000	1.000	FCSK_HUMAN L-fucose kinase OS=Homo sapiens OX=9606 GN=FCSK PE=1 SV=2
5	Q9LNJ9	1.65e-44	177	1055	0.113	0.116	FKGP_ARATH Bifunctional fucokinase/fucose pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=FKGP PE=1 SV=2
6	Q4QEX6	2.90e-37	154	1187	0.110	0.100	Q4QEX6_LEIMA Putative fucose kinase OS=Leishmania major OX=5664 GN=LMJF_16_0440 PE=4 SV=1
7	Q4QEX2	3.19e-37	154	1187	0.110	0.100	Q4QEX2_LEIMA Putative fucose kinase OS=Leishmania major OX=5664 GN=LMJF_16_0480 PE=4 SV=1
8	Q97EQ3	3.58e-16	84.0	364	0.067	0.201	Q97EQ3_CLOAB Sugar kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C3055 PE=4 SV=1
9	O14772	1.09e-08	61.6	607	0.111	0.198	FPGT_HUMAN Fucose-1-phosphate guanylyltransferase OS=Homo sapiens OX=9606 GN=FPGT PE=1 SV=3
10	G5E8F4	1.09e-07	58.5	590	0.100	0.183	FPGT_MOUSE Fucose-1-phosphate guanylyltransferase OS=Mus musculus OX=10090 GN=Fpgt PE=1 SV=1
11	Q0P8I9	0.048	39.7	339	0.051	0.162	HDDA_CAMJE D-glycero-alpha-D-manno-heptose 7-phosphate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=hddA PE=1 SV=1
12	Q6FSV1	2.4	34.7	563	0.019	0.037	Q6FSV1_CANGA Peptide hydrolase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G07623g PE=3 SV=1
13	Q8VHP6	3.6	34.3	859	0.017	0.021	CDHR1_MOUSE Cadherin-related family member 1 OS=Mus musculus OX=10090 GN=Cdhr1 PE=1 SV=1
14	Q6ICG6	5.7	33.1	404	0.021	0.057	K0930_HUMAN Uncharacterized protein KIAA0930 OS=Homo sapiens OX=9606 GN=KIAA0930 PE=1 SV=1
15	Q9HDV6	5.7	33.5	2196	0.018	0.009	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
16	P55824	9.6	32.7	2778	0.016	0.006	FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster OX=7227 GN=faf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07959 Fucokinase	3e-101	350.9	L-fucokinase
2	PF08544 GHMP_kinases_C	0.026	26.3	GHMP kinases C terminal
3	PF00288 GHMP_kinases_N	0.026	26.1	GHMP kinases N terminal domain
4	PF17226 MTA_R1	5.9e+02	12.1	MTA R1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288078

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359935	0.940	Fucose-1-phosphate guanylyltransferase
2	9606.ENSP00000370194	0.811	GDP-mannose 4,6 dehydratase
3	9606.ENSP00000346643	0.805	Putative hexokinase HKDC1
4	9606.ENSP00000267814	0.801	Sorbitol dehydrogenase
5	9606.ENSP00000260599	0.800	Ketohexokinase
6	9606.ENSP00000290573	0.800	Hexokinase-2
7	9606.ENSP00000292432	0.800	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
8	9606.ENSP00000402103	0.800	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
9	9606.ENSP00000398803	0.798	GDP-L-fucose synthase
10	9606.ENSP00000278550	0.690	Teneurin-4
11	9606.ENSP00000386357	0.690	Leucine-rich repeat transmembrane neuronal protein 4
12	9606.ENSP00000387498	0.680	Galactoside 2-alpha-L-fucosyltransferase 2
13	9606.ENSP00000002165	0.657	Plasma alpha-L-fucosidase
14	9606.ENSP00000305442	0.643	Conserved oligomeric Golgi complex subunit 7
15	9606.ENSP00000222388	0.631	ATP binding cassette subfamily F member 2
16	9606.ENSP00000385579	0.628	Uncharacterized protein KIAA1841
17	9606.ENSP00000312021	0.615	Galactoside 2-alpha-L-fucosyltransferase 1
18	9606.ENSP00000222747	0.600	Tetraspanin-12
19	9606.ENSP00000363603	0.598	Tissue alpha-L-fucosidase
20	9606.ENSP00000300413	0.589	Small nuclear ribonucleoprotein Sm D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050201	1.000	fucokinase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0006793	0.967	phosphorus metabolic process
GO:1901135	0.947	carbohydrate derivative metabolic process
GO:0044281	0.843	small molecule metabolic process
GO:0006796	0.820	phosphate-containing compound metabolic process
GO:0046483	0.799	heterocycle metabolic process
GO:0055086	0.790	nucleobase-containing small molecule metabolic process
GO:0009058	0.782	biosynthetic process
GO:1901576	0.626	organic substance biosynthetic process
GO:0044249	0.614	cellular biosynthetic process
GO:0019637	0.613	organophosphate metabolic process
GO:0005975	0.579	carbohydrate metabolic process
GO:1901137	0.520	carbohydrate derivative biosynthetic process
GO:0044271	0.355	cellular nitrogen compound biosynthetic process
GO:0034654	0.301	nucleobase-containing compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.617	membrane-bounded organelle
GO:0043231	0.511	intracellular membrane-bounded organelle
GO:0016020	0.489	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13241	1.000	ATP + L-fucose = ADP + beta-L-fucose 1-phosphate + H(+)
EC:2.7.1.52	1.000	fucokinase.

[back to server]