StarFunc result for job id Q8N0X4

User Input

>input (340 residues)
MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIK
KIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDL
ETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFK
AVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQA
IDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAA
FKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N0X4	1.000	1.000	2.114E-64	340	1.000	1.000	Q8N0X4.pdb.gz	CLYBL_HUMAN Citramalyl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=CLYBL PE=1 SV=2
2	AFDB:Q8R4N0	0.911	0.916	4.940E-55	338	0.809	0.814	Q8R4N0.pdb.gz	CLYBL_MOUSE Citramalyl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Clybl PE=1 SV=2
3	PDB:5vxcA	0.876	0.989	2.365E-54	301	0.885	1.000	5vxcA.pdb.gz	The Human Knockout Gene CLYBL Connects Itaconate to Vitamin B12.
4	AFDB:Q3J5L6	0.802	0.856	2.012E-23	318	0.241	0.258	Q3J5L6.pdb.gz	MCAL_CERS4 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=mcl1 PE=1 SV=1
5	AFDB:P0A9I1	0.779	0.872	2.837E-23	302	0.226	0.255	P0A9I1.pdb.gz	CITE_ECOLI Citrate lyase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=citE PE=2 SV=1
6	AFDB:B6E2X2	0.799	0.853	5.636E-23	318	0.247	0.264	B6E2X2.pdb.gz	MCAL_RHOCA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus OX=1061 GN=mcl1 PE=1 SV=1
7	PDB:4l9yC	0.773	0.829	5.599E-21	316	0.235	0.253	4l9yC.pdb.gz	The crystal structures of the tri-functional Chloroflexus aurantiacus and bi-functional Rhodobacter sphaeroides malyl-CoA lyases and comparison with CitE-like superfamily enzymes and malate synthases.
8	PDB:6aq4B	0.671	0.838	7.454E-21	268	0.265	0.336	6aq4B.pdb.gz	An essential bifunctional enzyme inMycobacterium tuberculosisfor itaconate dissimilation and leucine catabolism.
9	AFDB:S5N020	0.777	0.760	3.422E-20	348	0.238	0.233	S5N020.pdb.gz	MCLA_CHLAU Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase OS=Chloroflexus aurantiacus OX=1108 GN=mcl PE=1 SV=1
10	AFDB:P9WPE1	0.689	0.848	4.824E-20	273	0.268	0.333	P9WPE1.pdb.gz	CITEL_MYCTU Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=citE PE=1 SV=1
11	PDB:4l80C	0.751	0.737	2.445E-19	347	0.253	0.248	4l80C.pdb.gz	The crystal structures of the tri-functional Chloroflexus aurantiacus and bi-functional Rhodobacter sphaeroides malyl-CoA lyases and comparison with CitE-like superfamily enzymes and malate synthases.
12	AFDB:P95083	0.700	0.771	1.675E-18	307	0.247	0.274	P95083.pdb.gz	P95083_MYCTO Citrate lyase, beta subunit, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3160 PE=4 SV=1
13	AFDB:Q5V463	0.781	0.769	2.329E-17	346	0.203	0.199	Q5V463.pdb.gz	MCAL_HALMA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=citE1 PE=1 SV=1
14	AFDB:D4GTL2	0.719	0.574	2.734E-12	433	0.188	0.148	D4GTL2.pdb.gz	ACEB_HALVD Malate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aceB PE=1 SV=1
15	PDB:3oyzA	0.642	0.584	1.645E-11	376	0.188	0.170	3oyzA.pdb.gz	Crystal structures of a halophilic archaeal malate synthase from Haloferax volcanii and comparisons with isoforms A and G.
16	PDB:5taoA	0.640	0.613	3.087E-11	356	0.165	0.157	5taoA.pdb.gz	Crystal structures of a halophilic archaeal malate synthase from Haloferax volcanii and comparisons with isoforms A and G.
17	PDB:3cuzA	0.536	0.362	1.087E-10	529	0.162	0.104	3cuzA.pdb.gz	Atomic resolution structures of Escherichia coli and Bacillus anthracis malate synthase A: comparison with isoform G and implications for structure-based drug discovery
18	PDB:2vwtA	0.487	0.626	2.759E-7	256	0.106	0.141	2vwtA.pdb.gz	Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
19	PDB:1dxeA	0.484	0.631	3.469E-7	253	0.121	0.162	1dxeA.pdb.gz	Crystal Structures of the Metal-Dependent 2-Dehydro-3-Deoxy-Galactarate Aldolase Suggest a Novel Reaction Mechanism.
20	PDB:6v76D	0.499	0.406	9.176E-7	431	0.094	0.074	6v76D.pdb.gz	Biochemical and structural insights into how amino acids regulate pyruvate kinase muscle isoform 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N0X4	0.0	695	340	1.000	1.000	CLYBL_HUMAN Citramalyl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=CLYBL PE=1 SV=2
2	Q8R4N0	0.0	593	338	0.856	0.861	CLYBL_MOUSE Citramalyl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Clybl PE=1 SV=2
3	P9WPE1	4.87e-36	133	273	0.265	0.330	CITEL_MYCTU Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=citE PE=1 SV=1
4	Q3J5L6	4.43e-31	121	318	0.259	0.277	MCAL_CERS4 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=mcl1 PE=1 SV=1
5	B6E2X2	3.69e-28	113	318	0.265	0.283	MCAL_RHOCA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus OX=1061 GN=mcl1 PE=1 SV=1
6	P0A9I1	2.78e-24	102	302	0.229	0.258	CITE_ECOLI Citrate lyase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=citE PE=2 SV=1
7	S5N020	1.15e-21	96.3	348	0.256	0.250	MCLA_CHLAU Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase OS=Chloroflexus aurantiacus OX=1108 GN=mcl PE=1 SV=1
8	P95083	1.14e-17	84.3	307	0.256	0.283	P95083_MYCTO Citrate lyase, beta subunit, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3160 PE=4 SV=1
9	Q5V463	1.23e-07	55.1	346	0.209	0.205	MCAL_HALMA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=citE1 PE=1 SV=1
10	Q9SMY8	1.0	33.9	990	0.074	0.025	FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana OX=3702 GN=FBL15 PE=2 SV=2
11	Q99MN1	1.6	33.1	595	0.115	0.066	SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus OX=10090 GN=Kars1 PE=1 SV=1
12	P37879	1.7	33.1	597	0.115	0.065	SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus OX=10029 GN=KARS1 PE=1 SV=1
13	Q5XIM7	2.5	32.3	626	0.112	0.061	SYK_RAT Lysine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Kars1 PE=1 SV=1
14	F8W9J4	2.6	32.7	7461	0.050	0.002	F8W9J4_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=1
15	Q03001	2.6	32.7	7570	0.050	0.002	DYST_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4
16	X2KK07	2.6	32.3	813	0.082	0.034	X2KK07_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
17	Q8RXK2	2.7	32.3	782	0.062	0.027	SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana OX=3702 GN=SDN3 PE=1 SV=1
18	X2KN52	2.8	32.3	805	0.082	0.035	X2KN52_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
19	Q15046	2.9	32.3	597	0.115	0.065	SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3
20	Q9JI60	3.0	31.6	231	0.065	0.095	LRAT_MOUSE Lecithin retinol acyltransferase OS=Mus musculus OX=10090 GN=Lrat PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15617 C-C_Bond_Lyase	2.9e-07	41.6	C-C_Bond_Lyase of the TIM-Barrel fold
2	PF03328 HpcH_HpaI	7.3e-45	164.5	HpcH/HpaI aldolase/citrate lyase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358549	0.793	Probable arginine--tRNA ligase, mitochondrial
2	9606.ENSP00000349658	0.792	X-prolyl aminopeptidase 3
3	9606.ENSP00000198767	0.788	RNA polymerase I-specific transcription initiation factor RRN3
4	9606.ENSP00000444411	0.733	FERM and PDZ domain-containing protein 1
5	9606.ENSP00000344989	0.704	DALR anticodon-binding domain-containing protein 3
6	9606.ENSP00000330631	0.703	Reticulon-4 receptor-like 1
7	9606.ENSP00000342056	0.691	Citrate synthase, mitochondrial
8	9606.ENSP00000267294	0.620	Zinc finger protein ZIC 5
9	9606.ENSP00000355518	0.619	Fumarate hydratase, mitochondrial
10	9606.ENSP00000327070	0.570	Malate dehydrogenase, mitochondrial
11	9606.ENSP00000229270	0.565	Triosephosphate isomerase 1
12	9606.ENSP00000253792	0.519	ATP-citrate synthase
13	9606.ENSP00000263433	0.518	Protein phosphatase 1 regulatory subunit 12C
14	9606.ENSP00000346173	0.518	Electron transfer flavoprotein subunit beta
15	9606.ENSP00000265440	0.515	Transcription factor EC
16	9606.ENSP00000391601	0.501	Peroxisomal targeting signal 1 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047777	1.000	(S)-citramalyl-CoA lyase activity
GO:0046872	0.999	metal ion binding
GO:0016740	0.948	transferase activity
GO:0016746	0.938	acyltransferase activity
GO:0046912	0.922	acyltransferase activity, acyl groups converted into alkyl on transfer
GO:0005515	0.899	protein binding
GO:0000287	0.850	magnesium ion binding
GO:0004474	0.306	malate synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062012	0.995	regulation of small molecule metabolic process
GO:0009987	0.988	cellular process
GO:0030656	0.958	regulation of vitamin metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0050794	0.914	regulation of cellular process
GO:0016043	0.897	cellular component organization
GO:0031323	0.852	regulation of cellular metabolic process
GO:0044085	0.797	cellular component biogenesis
GO:0051259	0.666	protein complex oligomerization
GO:0008152	0.643	metabolic process
GO:0070206	0.638	protein trimerization
GO:0071704	0.396	organic substance metabolic process
GO:0044237	0.355	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.980	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22612	1.000	(3S)-citramalyl-CoA = acetyl-CoA + pyruvate
EC:4.1.3.25	1.000	(S)-citramalyl-CoA lyase.
EC:2.-.-.-	0.948	Transferases.
EC:2.3.-.-	0.938	Acyltransferases.
EC:2.3.3.-	0.922	Acyl groups converted into alkyl groups on transfer.
RHEA:18181	0.306	acetyl-CoA + glyoxylate + H2O = (S)-malate + CoA + H(+)
EC:2.3.3.9	0.306	malate synthase.

[back to server]