StarFunc result for job id Q8N0Z2

User Input

>input (381 residues)
MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSP
QAPKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYER
GGDVSHLSHRYERDAGVLEPGQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQE
EPTWRSDSVDTEDSGYGGEAEERPEQDGVQVAVVRIKRPLPSQVNRFTEKLNCKAQQKYS
PVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
RAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGILMRARKHGLV
DFEGEMLWQGRDDHVVITLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N0Z2	1.000	1.000	1.214E-63	381	1.000	1.000	Q8N0Z2.pdb.gz	ABRA_HUMAN Actin-binding Rho-activating protein OS=Homo sapiens OX=9606 GN=ABRA PE=1 SV=1
2	AFDB:O74363	0.120	0.080	7.344E-3	695	0.118	0.065	O74363.pdb.gz	YND2_SCHPO G-patch and R3H domain-containing protein C30B4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30B4.02c PE=4 SV=1
3	PDB:5hs7A	0.138	0.440	1.403E-1	102	0.034	0.127	5hs7A.pdb.gz
4	AFDB:Q9P0K7	0.111	0.056	1.518E-1	980	0.105	0.041	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
5	PDB:5znxA	0.134	0.423	1.702E-1	95	0.042	0.168	5znxA.pdb.gz
6	AFDB:Q9LUQ3	0.112	0.092	1.841E-1	490	0.139	0.108	Q9LUQ3.pdb.gz	SDE5_ARATH Putative nuclear RNA export factor SDE5 OS=Arabidopsis thaliana OX=3702 GN=SDE5 PE=4 SV=1
7	PDB:3jckF	0.125	0.123	2.349E-1	388	0.034	0.034	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
8	AFDB:A0A024R0V4	0.089	0.089	2.541E-1	380	0.097	0.097	A0A024R0V4.pdb.gz	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
9	PDB:5i2dG	0.125	0.218	2.673E-1	195	0.037	0.072	5i2dG.pdb.gz	Structural basis of transcription activation.
10	AFDB:Q55D99	0.102	0.044	2.711E-1	1197	0.142	0.045	Q55D99.pdb.gz	PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum OX=44689 GN=pakA PE=1 SV=1
11	AFDB:Q63488	0.098	0.060	3.083E-1	656	0.108	0.062	Q63488.pdb.gz	S20A2_RAT Sodium-dependent phosphate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc20a2 PE=1 SV=1
12	AFDB:Q757M9	0.138	0.096	3.083E-1	597	0.118	0.075	Q757M9.pdb.gz	Q757M9_EREGS AEL007Wp OS=Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AGOS_AEL007W PE=1 SV=2
13	PDB:5h3rA	0.123	0.284	3.458E-1	141	0.045	0.121	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
14	AFDB:Q96IZ0	0.087	0.096	3.741E-1	340	0.147	0.165	Q96IZ0.pdb.gz	PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1
15	AFDB:Q9VLS8	0.094	0.066	3.741E-1	585	0.105	0.068	Q9VLS8.pdb.gz	Q9VLS8_DROME LD29807p OS=Drosophila melanogaster OX=7227 GN=GalT4 PE=1 SV=2
16	PDB:6dk4A	0.158	0.390	4.196E-1	135	0.037	0.104	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
17	PDB:1r1uC	0.137	0.449	4.475E-1	98	0.037	0.143	1r1uC.pdb.gz
18	PDB:7qcdF	0.110	0.150	4.773E-1	257	0.071	0.105	7qcdF.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
19	PDB:1z9cC	0.130	0.315	5.091E-1	138	0.029	0.080	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
20	PDB:4zzlA	0.130	0.305	5.091E-1	146	0.034	0.089	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BUZ1	0.0	621	375	0.790	0.803	ABRA_MOUSE Actin-binding Rho-activating protein OS=Mus musculus OX=10090 GN=Abra PE=1 SV=1
2	Q8K4K7	0.0	615	375	0.782	0.795	ABRA_RAT Actin-binding Rho-activating protein OS=Rattus norvegicus OX=10116 GN=Abra PE=1 SV=2
3	Q8N0Z2	0.0	790	381	1.000	1.000	ABRA_HUMAN Actin-binding Rho-activating protein OS=Homo sapiens OX=9606 GN=ABRA PE=1 SV=1
4	Q68EG8	4.04e-116	343	359	0.507	0.538	Q68EG8_DANRE Actin-binding Rho-activating protein OS=Danio rerio OX=7955 GN=zgc:92005 PE=2 SV=1
5	B3WFX8	3.92e-34	125	145	0.150	0.393	B3WFX8_CAEEL Costars domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F36F2.1 PE=1 SV=1
6	O62234	9.81e-34	125	162	0.150	0.352	O62234_CAEEL Costars domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F36F2.1 PE=1 SV=1
7	Q8LBN7	6.81e-08	52.0	95	0.089	0.358	COSA_ARATH Costars family protein At4g33640 OS=Arabidopsis thaliana OX=3702 GN=At4g33640 PE=1 SV=1
8	Q558Y7	3.87e-05	43.9	82	0.068	0.317	COSA_DICDI Protein costars OS=Dictyostelium discoideum OX=44689 GN=cosA PE=2 SV=1
9	M9MRD4	0.94	34.3	8382	0.060	0.003	M9MRD4_DROME Muscle-specific protein 300 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
10	M9MRD6	1.1	34.3	11999	0.060	0.002	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
11	M9MRF5	1.1	34.3	11986	0.060	0.002	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
12	M9PCM8	1.1	34.3	11917	0.060	0.002	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9MRD1	1.2	33.9	12345	0.060	0.002	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9PC84	1.2	33.9	12308	0.060	0.002	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	M9PC23	1.3	33.9	7962	0.060	0.003	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	Q9JIA7	2.2	32.7	617	0.050	0.031	SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus OX=10090 GN=Sphk2 PE=1 SV=2
17	P15928	2.4	32.7	560	0.071	0.048	FLIF_SALTY Flagellar M-ring protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=fliF PE=1 SV=2
18	Q9SR02	5.1	32.0	1703	0.052	0.012	MED14_ARATH Mediator of RNA polymerase II transcription subunit 14 OS=Arabidopsis thaliana OX=3702 GN=MED14 PE=1 SV=1
19	Q9LXT9	5.3	32.0	1955	0.073	0.014	CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana OX=3702 GN=CALS3 PE=3 SV=3
20	Q86S74	5.8	31.2	339	0.034	0.038	Q86S74_CAEEL Activated in Blocked Unfolded protein response OS=Caenorhabditis elegans OX=6239 GN=abu-4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14705 Costars	1.8e-27	106.5	Costars

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362935	0.653	Integrin beta-1-binding protein 2
2	9606.ENSP00000216185	0.650	Thioredoxin, mitochondrial
3	9606.ENSP00000339086	0.645	MKL/myocardin-like protein 2
4	9606.ENSP00000347847	0.571	MKL/myocardin-like protein 1
5	9606.ENSP00000355166	0.558	Leucine-rich repeat-containing protein 10
6	9606.ENSP00000317214	0.553	Calpain-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.424	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.963	biological regulation
GO:0009987	0.960	cellular process
GO:0050794	0.896	regulation of cellular process
GO:0008152	0.645	metabolic process
GO:0031323	0.587	regulation of cellular metabolic process
GO:0080090	0.584	regulation of primary metabolic process
GO:0048856	0.525	anatomical structure development
GO:0048522	0.475	positive regulation of cellular process
GO:0031326	0.474	regulation of cellular biosynthetic process
GO:0031325	0.461	positive regulation of cellular metabolic process
GO:0019219	0.456	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0071704	0.446	organic substance metabolic process
GO:0044237	0.444	cellular metabolic process
GO:0044238	0.442	primary metabolic process
GO:0045944	0.425	positive regulation of transcription by RNA polymerase II
GO:0051179	0.364	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.985	membrane
GO:0005622	0.975	intracellular anatomical structure
GO:0005737	0.973	cytoplasm
GO:0043226	0.965	organelle
GO:0043229	0.959	intracellular organelle
GO:0005886	0.951	plasma membrane
GO:0043231	0.775	intracellular membrane-bounded organelle
GO:0005634	0.555	nucleus
GO:0043232	0.474	intracellular non-membrane-bounded organelle
GO:0099512	0.342	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]